CAZyme Information: MGYG000004561_00544

Basic Information

• Species: Prevotella sp002480935
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002480935
• CAZyme ID: MGYG000004561_00544
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
699	MGYG000004561_7|CGC1	78747.35	6.9837

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004561	3001921	MAG	France	Europe

• Gene Location: Start: 311; End: 2410 Strand: +

Full Sequence      

MRLKINEYTITMHRKIYFVAIVSALLPLQAHAQHDGLTDMRNSKMALMVNTPMGAVKWTG
GFWGDRFNTLAGTSVWDMWRTWADPNVSHGFRNFEVAAGTVKGEHKGPPFHDGDMYKWLE
GAAAIYGITHDKRLDQLMDSFITQVALAQRADGYIHTPVVISERNKGIDSHADNTVIGIS
VGKDQKRAFASRLNFETYNLGHLITAGIVHKRVTGKDNLFKCSVKAADFLYNFLKNDRDE
LARNAICPSHYMAAFELYRETGDKRYLELGEGLIGIRDSVRNGEDHNQDRIPFRQQYEAV
GHAVRANYLYAGVADEYAETGEQQLMKNLSSIWDDIANHKIYITGGCGALYDGVSPDGTT
YDQPSIQQVHQAYGRKFQLPNEASHNETCAQIGELLYSWRMYETTANAKYADMVENELYN
GILPGISLDGTKYFYTQALRKSADFPYVLRWPKERQKYISCFCCPPNTLRTLAEAQEYAY
TVSKDASELYVNLFGDNQLREKGLWLEQQTDYPFDGKVVITVKQAPKTLRTIALRIPSCA
GDLAVADVKGKVSGMKNGFVTFTGKWQKGDQVTIDLGLMPQLVEANPLVEESKNQVAVKY
GPVVYCLEAADIEGGYNINDVQIPADIALTPVDMTIAGHTFKALEGTARVVTEPKWNNNQ
LYRPVANVQKKDVRIRLIPYYAWGNRGNMDMTVWMNLER

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	56	606	1e-163	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.90e-164	55	606	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.04e-113	60	699	20	589	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD40914.1	1.30e-307	18	699	5	695
ABR40298.1	5.14e-299	14	699	2	698
QUT58578.1	5.14e-299	14	699	2	698
QQY37562.1	5.14e-299	14	699	2	698
QEW37287.1	2.08e-298	14	699	2	698

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQO_A	2.81e-294	30	699	18	698	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
6EX6_A	1.38e-104	52	698	11	626	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	7.32e-99	84	696	48	646	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.33e-95	84	696	48	646	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	1.41e-78	88	693	51	654	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	7.72e-78	88	693	51	654	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000819	0.998147	0.000294	0.000264	0.000230	0.000201

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004561_00544.