CAZyme Information: MGYG000004563_00874

Basic Information

• Species: Methanosphaera sp900322125
• Lineage: Archaea; Methanobacteriota; Methanobacteria; Methanobacteriales; Methanobacteriaceae; Methanosphaera; Methanosphaera sp900322125
• CAZyme ID: MGYG000004563_00874
• CAZy Family: GT66
• CAZyme Description: Dolichyl-phosphooligosaccharide-protein glycotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
850	MGYG000004563_16|CGC1	94306.84	5.2758

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004563	1759917	MAG	France	Europe

• Gene Location: Start: 20101; End: 22653 Strand: +

Full Sequence      

MDNKNLVRKIAPFIIAILLVLAVFAVRAETINLGGITDESQKALYEDDSGMPYFTEIDSY
YNYRLTENYLNTGHLGDTVVNDSDWDSLSTSPNGREADYQPTIVVLAAAVYNIVNMFGNV
SLTQVAFWLGPIIGSLAVLPAYFIVRRSTGNEWGAIVAGVIAGAAPAYFSHTYAGFFDTD
MFNVLIPLMIALFLTESVYAKKPVYKVLYSVIAALFLALFSLSWSGYTYMVLLTFGTLIL
YLPASYFMDRLDGKKIPNNVQWLKDNPVTIPLVVFIVLSCILLLITVGTGTIESLINVIG
MSTSLQNATVGSAYPNVYVSVGEMQVPAVIDVANQSGGLFALLFAVLCIPLFIYLLRKKP
KTEKKSAQKVEKTKTDVSDKKVRNKRYTPKTKKAEEMVQHEHVFRPGKFEWTQHEKYNQL
FLFLLTLFWIIGISIMLMQGTRFIEQFAVPVALLSGLFVGFIVKYIDLKTEKYSYVALLA
AILVLLAVVSPVVADHTTASQAVGSTDDNMYNTLTWVKANTPQDTVLASWWDFGHLFTAV
ADRQVVFDGGSQNNMRAYWIGNALQTHNENLSAGILRMLANSGEDASNTLDLYTNDTSKS
VEILNAILPMDRTQANAALIGTYGLNQQQANSVLDLTHPAHTKPINLILSSDMLSKAAWW
SYFGTWNFTSENSTHYSYYPAQSSTENVNGQPFTMGMENGVIGVGSTSNDTNSTPMTFAY
VDQTKLNKSLNMSTAEDKQRMAKELSDGTGNELIKPHKIIYISGNQLSERIVNNNSNMSI
MAMQQDDGSYFTILFDSYLEDSVFTKLYLEGGMNTTRFNMTHSEPGISVWDVYEYPNNNT
NAVQAVNTTS

Enzyme Prediction     

No EC number prediction in MGYG000004563_00874.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	22	702	5.9e-152	0.9393939393939394

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1287	Stt3	3.52e-52	10	691	16	698	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
pfam02516	STT3	6.34e-52	27	551	4	478	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
pfam13231	PMT_2	4.93e-05	117	242	17	129	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABC56771.1	0.0	1	837	1	836
AWX32536.1	0.0	1	849	1	849
AEG18866.1	1.52e-212	1	832	1	820
SCG86282.1	2.87e-205	1	832	1	814
ADZ08786.1	3.74e-197	1	832	1	815

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FTJ_5	4.30e-07	508	612	503	601	Cryo-EMStructure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]
6FTG_5	4.32e-07	508	612	503	601	Subtomogramaverage of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6S7O_A	4.32e-07	508	612	503	601	Cryo-EMstructure of human oligosaccharyltransferase complex OST-A [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2EMT4	1.35e-71	14	668	40	734	Dolichyl-phosphooligosaccharide-protein glycotransferase OS=Methanococcus voltae OX=2188 GN=aglB PE=1 SV=1
Q58920	4.20e-66	10	832	25	925	Dolichyl-phosphooligosaccharide-protein glycotransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=aglB PE=3 SV=1
Q8U4D2	1.06e-12	53	550	50	533	Dolichyl-phosphooligosaccharide-protein glycotransferase 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=aglB1 PE=1 SV=1
O74088	6.60e-09	53	550	52	535	Dolichyl-phosphooligosaccharide-protein glycotransferase 1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=aglB1 PE=1 SV=1
F1PJP5	2.37e-06	508	612	503	601	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Canis lupus familiaris OX=9615 GN=STT3A PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.056455	0.930793	0.011644	0.000384	0.000334	0.000336

TMHMM  Annotations     

start	end
10	27
103	120
124	146
153	175
181	200
207	224
228	247
268	290
337	356
420	437
447	466
473	495