CAZyme Information: MGYG000004563_01173

Basic Information

• Species: Methanosphaera sp900322125
• Lineage: Archaea; Methanobacteriota; Methanobacteria; Methanobacteriales; Methanobacteriaceae; Methanosphaera; Methanosphaera sp900322125
• CAZyme ID: MGYG000004563_01173
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364		42136.08	9.201

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004563	1759917	MAG	France	Europe

• Gene Location: Start: 1226; End: 2320 Strand: +

Full Sequence      

MDYTYNGKPNYELIVVNDGSDDKTGEILSDLKKEYPHLRIITRKPPKSGKGKGFVLNDAL
ALSYGSILGVFDADTWVKPDFLTKLIPYLNNPKVQGVQCRVRMYNKDYNFLTNMQDVEFS
GFGNILRAKDNLKFNGFLGGNGQFVKKDAIIKAGKWDGFAVTEDLNLSVKLLISGGEIRY
CPEVSVYQEAVDNWHDFMKQRVRWAMGNFETLFVYFSRILTCKLPFYKKVGIIFHISNYA
FNLFIFVGFLIFIINIIGWFVLHIPTVIRMEAPLIIGIISAVGFFPGISIALIHDDKKYL
KFIKDLIEYWIYCFHLIPLFFITMWDMITRVERRWAKTTHKGIENEENKNQRLEGKNEKE
GYVN

Enzyme Prediction     

No EC number prediction in MGYG000004563_01173.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	70	251	1.1e-28	0.9644670050761421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	8.76e-47	9	343	83	427	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	4.46e-39	9	164	25	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06436	GlcNAc-1-P_transferase	5.76e-35	8	164	23	191	N-acetyl-glucosamine transferase is involved in the synthesis of Poly-beta-1,6-N-acetyl-D-glucosamine. N-acetyl-glucosamine transferase is responsible for the synthesis of bacteria Poly-beta-1,6-N-acetyl-D-glucosamine (PGA). Poly-beta-1,6-N-acetyl-D-glucosamine is a homopolymer that serves as an adhesion for the maintenance of biofilm structural stability in diverse eubacteria. N-acetyl-glucosamine transferase is the product of gene pgaC. Genetic analysis indicated that all four genes of the pgaABCD locus were required for the PGA production, pgaC being a glycosyltransferase.
PRK11204	PRK11204	3.67e-29	1	312	79	385	N-glycosyltransferase; Provisional
pfam13632	Glyco_trans_2_3	9.30e-25	72	261	6	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGN16470.1	6.67e-215	1	350	333	682
ATZ59897.1	5.94e-169	1	344	245	588
ALT69388.1	6.36e-155	2	342	243	583
AGN16484.1	1.75e-146	1	344	434	777
BBL61757.1	6.18e-140	1	342	418	758

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	5.81e-07	8	112	42	141	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P74165	1.71e-29	11	232	140	360	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q3MB01	2.87e-29	11	342	138	465	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
Q8YMK0	5.40e-29	11	224	138	350	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
P96587	1.79e-26	5	246	75	313	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q8GLC5	1.08e-18	9	227	75	291	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000014	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
240	262
272	294
306	328