CAZyme Information: MGYG000004564_00564

Basic Information

• Species: An23 sp900544635
• Lineage: Bacteria; Synergistota; Synergistia; Synergistales; Synergistaceae; An23; An23 sp900544635
• CAZyme ID: MGYG000004564_00564
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332	MGYG000004564_7|CGC1	36518.99	10.2454

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004564	2339213	MAG	France	Europe

• Gene Location: Start: 36589; End: 37587 Strand: -

Full Sequence      

MHFIPSVARNAATKIAQTAKAGKAKIFLRSCAALCLLLLCVWGFSEAVYKVTAGGWGAGR
RAWKAGDCEAALAAWSRGAWAQPFAIRPARLYYWKIRALEKLGRADEAERTAALLALRRP
LDFYAFVLAYEGKYPKLTRAVNAAKSRALPARRWEAEAAAASARTGVRENVLFGIMKRES
KFDPNALSARGAVGLMQLMPPTAREAAQRLGDEALSPFVPEQNVMLGAAHFAYLHAKFRR
RLPLSVAAYNAGAAAVSKWGADEASDWIEWIEDIPYPQTREYVRSVLENIEIYDFGGASA
TRGRRSFFAWAGLPPSLGGEFAEKRENSAQME

Enzyme Prediction     

No EC number prediction in MGYG000004564_00564.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	168	291	5.2e-27	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	2.27e-39	165	294	17	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	2.80e-31	165	292	15	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	9.18e-26	172	291	4	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.46e-17	42	294	24	284	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.73e-16	166	261	9	104	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANZ45896.1	3.95e-109	1	317	1	321
ADE56509.1	1.96e-29	56	293	351	651
AFM21693.1	3.54e-27	93	293	446	646
QDZ07491.1	9.45e-24	170	294	503	635
QPQ55669.1	4.33e-23	175	294	519	647

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	4.79e-21	166	293	461	592	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	4.97e-21	166	293	490	621	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FC4_A	1.18e-20	166	293	462	593	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FCQ_A	1.18e-20	166	293	461	592	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
5MPQ_A	4.31e-18	172	293	434	555	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44888	1.65e-13	167	295	441	570	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
P0AGC4	7.47e-13	167	287	493	619	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	7.47e-13	167	287	493	619	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	4.29e-12	167	287	493	619	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31608	2.44e-11	166	286	72	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999906	0.000087	0.000000	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
26	45