CAZyme Information: MGYG000004564_01214

Basic Information

• Species: An23 sp900544635
• Lineage: Bacteria; Synergistota; Synergistia; Synergistales; Synergistaceae; An23; An23 sp900544635
• CAZyme ID: MGYG000004564_01214
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000004564_21|CGC1	41526.69	7.6195

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004564	2339213	MAG	France	Europe

• Gene Location: Start: 20664; End: 21788 Strand: -

Full Sequence      

MSIFISSGEASGDHYTARLAMKLRERGYSGDIWGMGGVESRNAGVRAEWNGERLQLLGLT
EVFSAIPSILALRREMVERIIERAPEAVVVCDSPDYHMRLIAKLRARGYRGKIFYLSPPT
VWAWRSGRANDLRRDVDECLPLFKFEHDYLLSRGCASAWRGHPLLEEYNHRAETPDLGVD
YEPGKLVAFLPGSRGSEIKSLLPIMEEAASALGSMGWQPVFSVAPGLNPTVRAEMIRRFS
EKGIRHYDGPGGALMEAADCAVGASGTITVEALLRRRYMVVTYRLNPISALVARCVIKTK
YYAMANILAGCEMFPELLQEKATAANLTDAALAWLEDRGGLRRRTGEVMERARATLGEEG
VYDFWCSRITGEAA

Enzyme Prediction     

No EC number prediction in MGYG000004564_01214.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	352	2e-86	0.980225988700565

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	6.30e-85	1	337	2	344	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	3.07e-80	1	356	2	359	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	4.87e-76	3	362	1	364	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	2.21e-43	2	327	228	568	lipid-A-disaccharide synthase; Reviewed
PRK14089	PRK14089	1.62e-36	1	330	2	312	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANZ45970.1	2.16e-191	1	374	1	375
AER66289.1	9.11e-109	1	369	1	366
QTX31623.1	4.03e-91	1	369	1	366
QVL35430.1	1.14e-90	1	369	1	366
AFM20975.1	2.00e-87	1	369	1	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.21e-35	1	335	7	345	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	6.23e-35	1	335	7	345	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	2.97e-55	3	360	7	365	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
C1DST3	3.19e-53	1	336	5	345	Lipid-A-disaccharide synthase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) OX=322710 GN=lpxB PE=3 SV=1
Q2IL69	4.81e-53	3	360	11	369	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
Q6ALW0	1.02e-52	3	360	12	373	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
B8JE78	7.22e-52	3	360	11	369	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998534	0.001354	0.000100	0.000008	0.000004	0.000019

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004564_01214.