CAZyme Information: MGYG000004565_00945

Basic Information

• Species: Peptostreptococcus stomatis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Peptostreptococcus; Peptostreptococcus stomatis
• CAZyme ID: MGYG000004565_00945
• CAZy Family: GH166
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
282	MGYG000004565_20|CGC1	32691.55	6.2867

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004565	1730330	MAG	France	Europe

• Gene Location: Start: 15967; End: 16815 Strand: -

Full Sequence      

MRLVGRQKSVKIIAGILIISVCILALLSLLGIFKGMDKKKDYGVFLGIEKTEIHKLDGYK
TVVIDPSNFTKSDIDQLHKENKLVYGYLNIGSIEKFRPYYKNYEKLTLATYENWPDEHWI
DVTSNDWQEFVVKNLGKKYADKGIDGFFIDNTDVYYQYPREEIFQGLTSIMKGLRDYKLK
IIINGGDPFVSRCIDEKIAKDLFDGINQECVFTSIDFDNKSYGIQAKDETKRYKEYLSKV
KKAGLEVYLLEYGAGASIQEMIDEYCKQNDFKYYNAESLELK

Enzyme Prediction     

No EC number prediction in MGYG000004565_00945.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH166	61	277	1.6e-60	0.9776785714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3868	COG3868	8.02e-24	58	253	79	275	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
pfam03537	Glyco_hydro_114	2.68e-20	62	271	20	210	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
COG2342	COG2342	7.01e-15	58	253	43	252	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].
cd06591	GH31_xylosidase_XylS	7.94e-04	74	179	72	182	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASS38385.1	3.91e-108	20	281	13	274
ACV23220.1	2.07e-106	40	282	16	258
VEH02333.1	2.91e-106	40	282	26	268
QUI95081.1	5.96e-98	40	282	34	276
VEU55673.1	9.90e-97	36	282	40	287

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999529	0.000423	0.000004	0.000004	0.000002	0.000056

TMHMM  Annotations     

start	end
12	33