CAZyme Information: MGYG000004565_01192

Basic Information

• Species: Peptostreptococcus stomatis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Peptostreptococcus; Peptostreptococcus stomatis
• CAZyme ID: MGYG000004565_01192
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
186	MGYG000004565_29|CGC1	21512.04	10.2626

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004565	1730330	MAG	France	Europe

• Gene Location: Start: 16900; End: 17460 Strand: +

Full Sequence      

MKVRNKKVNKGLLALILVFVVFMLALINREKIEKTFYPIKYSKYVEKYSTEYGVDKYLVY
SIIKTESKFHTRATSSKNAKGLMQITDMTADWGREELGLGKVDIYDPETNINIGVWYLGK
LQKEFKGNNKLIIAAYNGGSGNVRKWLRSADYSKDGRNLANIPFVETSKYTQKVLDNYKK
YKALYK

Enzyme Prediction     

No EC number prediction in MGYG000004565_01192.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	56	181	4.6e-31	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	3.00e-68	38	180	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.64e-50	37	184	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	6.01e-38	58	179	3	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	3.01e-35	23	185	121	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	2.06e-32	47	159	3	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPK99408.1	1.86e-65	9	185	3	178
AVD40846.1	1.86e-65	9	185	3	178
QQY50391.1	1.86e-65	9	185	3	178
QQY75444.1	1.86e-65	9	185	3	178
AXU49364.1	1.86e-65	9	185	3	178

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.13e-18	45	185	420	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.14e-18	45	185	424	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.14e-18	45	185	434	573	Lytictransglycosylase in action [Neisseria meningitidis]
6FPN_B	1.14e-18	45	185	430	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O29_A	1.15e-18	45	185	440	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44888	8.55e-16	38	175	425	566	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31608	2.93e-15	45	178	64	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P0AGC4	2.17e-13	37	181	476	627	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	2.17e-13	37	181	476	627	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	2.17e-13	37	175	476	619	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.857219	0.137561	0.003533	0.000304	0.000232	0.001156

TMHMM  Annotations     

start	end
12	29