CAZyme Information: MGYG000004578_00896

Basic Information

• Species: UMGS1795 sp900553555
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UMGS1795; UMGS1795 sp900553555
• CAZyme ID: MGYG000004578_00896
• CAZy Family: CE15
• CAZyme Description: Carbohydrate esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359		40884.3	6.3964

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004578	1540237	MAG	France	Europe

• Gene Location: Start: 9395; End: 10474 Strand: +

Full Sequence      

MQSTEKNQDGSLLLDYRLPELMEDKTAGTKHWRARREEIIRLLSQQEYGFIPPHLPANVK
TTEKKRYFAGKGILETPVFGFNNQGESFELKANLIYPDGGKQYPFFVFANFSKDVPDKYF
PAEELIDRGFGVISFFYQDVSKDENSFGEGLERLFLKQRRGGDTFGKISLWAWAMSAMLD
YIFDRKLVLNNRVGAIGHSRLGKTALWAAANDERFSFVFSNDSGCSGAALSRNKQGETVA
DITAVFPHWFCKNYLDYAGREDEIPFDQHFLLSLIAPRTLVVGAAKEDTWADTINQYLCC
KAAMPAYALYGMGGGFDDDKPVTGKKYGANGIFFRERTGMHYLSRDDWHFYMDIMTDKI

Enzyme Prediction     

No EC number prediction in MGYG000004578_00896.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	27	356	4.1e-67	0.9256505576208178

CDD Domains     

MGYG000004578_00896 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE95892.1	2.08e-82	18	355	11	357
QDU94458.1	3.40e-72	7	353	28	420
QNK58798.1	2.03e-69	33	353	28	365
QDV48321.1	1.84e-68	2	353	25	420
AEW47971.1	2.77e-67	9	359	26	420

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GRW_A	1.18e-59	121	352	156	390	GlucuronoylEsterase from Opitutus terrae (Au derivative) [Opitutus terrae PB90-1],6GS0_A Native Glucuronoyl Esterase from Opitutus terrae [Opitutus terrae PB90-1]
6SYU_A	1.83e-59	121	352	174	408	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with xylobiose [Opitutus terrae],6T0I_A The wild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with the aldotetrauronic acid XUX [Opitutus terrae]
6SYR_A	2.69e-59	121	352	185	419	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1]
6SYV_A	5.08e-59	121	352	174	408	Theglucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1],6SZO_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-galacturonate [Opitutus terrae PB90-1],6T0E_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1],6T0E_B The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1]
7B7H_A	1.41e-58	121	352	174	408	ChainA, Putative acetyl xylan esterase [Opitutus terrae PB90-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0K2VM55	1.31e-53	7	353	31	421	Carbohydrate esterase MZ0003 OS=Unknown prokaryotic organism OX=2725 GN=MZ0003 PE=1 SV=1
B2ABS0	4.17e-22	24	311	133	412	4-O-methyl-glucuronoyl methylesterase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=ge1 PE=1 SV=1
D8QLP9	1.62e-20	32	312	54	325	4-O-methyl-glucuronoyl methylesterase OS=Schizophyllum commune (strain H4-8 / FGSC 9210) OX=578458 GN=SCHCODRAFT_238770 PE=1 SV=1
P0CU53	3.94e-19	17	312	44	339	4-O-methyl-glucuronoyl methylesterase 1 OS=Wolfiporia cocos (strain MD-104) OX=742152 GN=WOLCODRAFT_23632 PE=1 SV=1
P0CT87	1.03e-18	34	312	131	404	4-O-methyl-glucuronoyl methylesterase 1 OS=Phanerochaete chrysosporium (strain RP-78 / ATCC MYA-4764 / FGSC 9002) OX=273507 GN=e_gw1.18.61.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004578_00896.