CAZyme Information: MGYG000004582_02228

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-81
• CAZyme ID: MGYG000004582_02228
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	MGYG000004582_39|CGC1	44251.88	5.0089

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004582	2816599	MAG	France	Europe

• Gene Location: Start: 5186; End: 6352 Strand: +

Full Sequence      

MKRIYLGLAVSVLLAVSSFPSYAGQWKQDTAGWKYESDDHTFLQDQWFQDYDGKWYYFES
DGYMSANCMTPDGYVTGADGAWIEGLGQSKDQAVLPWQYQTFLGKGLDVTWAEFQKRTRT
YSIKQVQEFKKAGVSHVRIRVQDDISTELLALLDMQVTDCLKNGIIPVIAYQAHEFKTDP
TKENMDHVTEWWSQIAEHFKDASHLLAFDLMIESSDAINKLPDTLNEMYEQTVAAIRKTN
PDRIIMISPRLRSDPNYLSELKIPSAHNGYLMAEWHFYASGPDKANEKKLWTTGTDAEKK
LITDKIQTALAWQQQTGIPTWVGAWMPGNYNKGNTYSIEEQTVFAGFMTKALSDAGIPFA
VNADTKYYNAAENTWISSMQPVFKTIFQ

Enzyme Prediction     

No EC number prediction in MGYG000004582_02228.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	122	361	5.4e-28	0.9541984732824428

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.37e-13	127	335	31	246	Cellulase (glycosyl hydrolase family 5).
COG5263	COG5263	1.26e-06	26	83	257	313	Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism].
NF033840	PspC_relate_1	3.27e-05	26	83	592	647	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.
pfam19085	Choline_bind_2	7.91e-05	56	82	11	38	Choline-binding repeat. this entry contains a pair of presumed choline-binding repeats that are often found adjacent to pfam01473.
NF033838	PspC_subgroup_1	1.98e-04	21	83	623	683	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIB28168.1	1.38e-134	91	387	2	298
QCI58964.2	2.70e-124	90	388	27	325
QMW91197.1	5.52e-124	94	386	29	321
BBK76626.1	5.52e-124	94	386	29	321
QCJ07784.1	5.52e-124	96	386	31	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4U5I_A	7.76e-16	128	375	114	369	ChainA, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U5I_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U5K_A Chain A, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U5K_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405]
4U3A_A	3.39e-15	128	323	114	313	ChainA, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U3A_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405]
5BYW_A	6.79e-13	128	323	114	324	ChainA, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_C Chain C, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_D Chain D, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_E Chain E, Endoglucanase H [Acetivibrio thermocellus ATCC 27405]
3NCO_A	1.87e-11	135	337	66	271	Crystalstructure of FnCel5A from F. nodosum Rt17-B1 [Fervidobacterium nodosum Rt17-B1],3NCO_B Crystal structure of FnCel5A from F. nodosum Rt17-B1 [Fervidobacterium nodosum Rt17-B1]
3RJX_A	1.87e-11	135	337	66	271	CrystalStructure of Hyperthermophilic Endo-Beta-1,4-glucanase [Fervidobacterium nodosum Rt17-B1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25472	1.61e-16	128	369	64	313	Endoglucanase D OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCD PE=3 SV=1
P16218	3.77e-14	128	323	365	564	Endoglucanase H OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000289	0.998995	0.000169	0.000194	0.000171	0.000146

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004582_02228.