CAZyme Information: MGYG000004586_01566

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C
• CAZyme ID: MGYG000004586_01566
• CAZy Family: CBM78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346		37549.32	3.8166

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004586	2425197	MAG	France	Europe

• Gene Location: Start: 5240; End: 6280 Strand: -

Full Sequence      

MVAMAENDSIPTLENFQMEKAGWLYFCPWYDGGSEDTNFLSNPTFNKVEDLVEIYQSDYC
ITLDELPEDLYDNGGTVITTTTKEGQTTTSTTKTTTVTTTTTKVEDAIMADIKKANGNYK
ISFSKEMGDEVHLVFDADKTVSYANGCLGISATVDGTDYWVSYKWEISKSGETVVSLNDA
PFNVTYNSGKDEVTDENEIAKIVAEAKKQNNAEVQIWWANDAAGEATDTAKVVLTAAYIP
DNSGTETTTTATTVDTDETTTTAETTTTTIGSDDGLTGDINLDGKVDLLDSICLNKHLAK
QITLEGQAFTNANCNQADGTITVNEDDGIALLNFVVLLINKLPVME

Enzyme Prediction     

EC	3.2.1.78

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM78	115	241	6.3e-47	0.9846153846153847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14256	Dockerin_I	9.35e-07	278	323	2	46	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCZ84116.1	2.15e-105	1	338	442	808
CDE12720.1	2.11e-90	1	343	454	835
ERJ92224.1	8.92e-86	1	344	454	848
CDE29814.1	1.69e-63	1	344	449	829
ADU21037.1	1.94e-24	1	76	455	530

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4V17_A	4.56e-16	121	246	22	150	Structureof a novel carbohydrate binding module from glycoside hydrolase family 5 glucanase from Ruminococcus flavefaciens FD-1 [Ruminococcus flavefaciens FD-1],4V17_B Structure of a novel carbohydrate binding module from glycoside hydrolase family 5 glucanase from Ruminococcus flavefaciens FD-1 [Ruminococcus flavefaciens FD-1],4V1B_A Structure of a novel carbohydrate binding module from glycoside hydrolase family 5 glucanase from Ruminococcus flavefaciens FD-1 collected at the Zn edge [Ruminococcus flavefaciens FD-1],4V1B_B Structure of a novel carbohydrate binding module from glycoside hydrolase family 5 glucanase from Ruminococcus flavefaciens FD-1 collected at the Zn edge [Ruminococcus flavefaciens FD-1],4V1I_A Structure of a novel carbohydrate binding module from glycoside hydrolase family 5 glucanase from Ruminococcus flavefaciens FD-1 at medium resolution [Ruminococcus flavefaciens FD-1],4V1I_B Structure of a novel carbohydrate binding module from glycoside hydrolase family 5 glucanase from Ruminococcus flavefaciens FD-1 at medium resolution [Ruminococcus flavefaciens FD-1]
4V18_A	4.56e-16	121	246	22	150	SeMetstructure of a novel carbohydrate binding module from glycoside hydrolase family 5 glucanase from Ruminococcus flavefaciens FD-1 [Ruminococcus flavefaciens FD-1],4V18_B SeMet structure of a novel carbohydrate binding module from glycoside hydrolase family 5 glucanase from Ruminococcus flavefaciens FD-1 [Ruminococcus flavefaciens FD-1]
3ZM8_A	7.53e-08	1	66	388	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000091	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004586_01566.