CAZyme Information: MGYG000004586_02040

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C
• CAZyme ID: MGYG000004586_02040
• CAZy Family: GH5
• CAZyme Description: Endoglucanase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
189	MGYG000004586_241|CGC1	21035.34	4.4466

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004586	2425197	MAG	France	Europe

• Gene Location: Start: 2845; End: 3414 Strand: -

Full Sequence      

MNEPRVIGSSTEWSGGTPEERDVINQLFQAFVDTVRASGGLNADRTLIVTSHAQSITKEA
VSAVQIPNDDHIAVSIHSYAPWDFCGTEDDRSEWGSEADKQELDSNFQYLADTFISKGVP
VLLDEFGAVNKNNTSIRANYYAYYVKSAKAHGITCFVWDNGTEKEFGLLNRKNLTWYAPS
IVEAMMQVL

Enzyme Prediction     

No EC number prediction in MGYG000004586_02040.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	1	161	1.2e-48	0.5833333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.42e-26	1	161	128	269	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	3.44e-13	1	186	188	391	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMO13178.1	2.72e-119	1	189	173	361
CCZ83818.1	1.94e-118	1	189	528	716
CDE11886.1	2.13e-95	1	185	520	705
CDE32105.1	8.40e-93	1	187	511	699
ERJ92483.1	5.33e-81	1	185	543	729

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PZ7_A	2.11e-49	1	185	144	333	GH5-4broad specificity endoglucanase from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]
3NDY_A	1.50e-48	1	187	147	339	Thestructure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDZ_A The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans]
6MQ4_A	1.99e-47	1	187	155	347	ChainA, cellulase [Acetivibrio cellulolyticus]
4IM4_A	2.65e-47	1	187	141	333	ChainA, Endoglucanase E [Acetivibrio thermocellus],4IM4_B Chain B, Endoglucanase E [Acetivibrio thermocellus],4IM4_C Chain C, Endoglucanase E [Acetivibrio thermocellus],4IM4_D Chain D, Endoglucanase E [Acetivibrio thermocellus],4IM4_E Chain E, Endoglucanase E [Acetivibrio thermocellus],4IM4_F Chain F, Endoglucanase E [Acetivibrio thermocellus]
6Q1I_A	1.33e-45	1	187	158	351	GH5-4broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum],6Q1I_B GH5-4 broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P28623	6.14e-47	1	187	178	370	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P54937	1.85e-44	1	187	183	376	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
P10477	5.82e-44	1	187	191	383	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
P28621	3.12e-42	1	187	177	372	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
P16216	6.50e-42	1	183	208	392	Endoglucanase 1 OS=Ruminococcus albus OX=1264 GN=Eg I PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004586_02040.