CAZyme Information: MGYG000004587_00434

Basic Information

• Species: UBA1409 sp900553675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1409; UBA1409 sp900553675
• CAZyme ID: MGYG000004587_00434
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1275		140205.68	4.5059

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004587	2560840	MAG	France	Europe

• Gene Location: Start: 97056; End: 100883 Strand: +

Full Sequence      

MKKLLSAVLIVLLTVTMALPAFATEDDGLKLELVSDKESYSSEDEIVLSLSAQNDSRLDI
KDITLKHIAPEGYEAPQDSELSGYLASGNRMSLKAVYGGKGSAAGGNILMIIGIAAAVVV
VAVIAVIIAKGKKGKNAAAMAVCMALLGSVAASAVPINAAGNTQTQELSCNVSVDGKDVI
FKAEVTYMKPLDNSAKVTLANSTGAAPVYIDPKSPAYDGLSLIAEAYADDIEALCGVRPE
IAQTEPTSGTYVIAGVVDDELIASMNLNWSISPSNGDFKSEQWERYEIKVVEDGGKTKIV
IAGSDKRGAIYGLFHITQDIFGVSPWIWWADIKPAHKDELVCTAAELETVSKRPSVNFRG
FFMNDENPCLNGFADSHFGGLNYMFYDEIFKLILRLKGNYMWPAMWSNNFSNDGMEGVKG
EFAELEKQYHYKLGGLMYVDQPGNEGASNNTPNTNINAEPDKVLGKGEYPMTLANAVLAD
RYGVVVGASHHEPMARSGGEWGGLQGYWGGKTTYTDPEIKSADGQKVWNYLLNPNNLESF
WSDAIYRNGSFDNLFTIGMRGENDSALIDDTGRTLTTEENIDLLKAVLRTQDKILKNHGL
GDTPSLIAVYKEVENCWYGGSRNDPKAAKGKGLRDDPEVTELLGADTNRIVMLCEDNNGY
LRTMPELDEKDKFNWGLYYHFDYVGSPKTSMWINTMPLQRTWENLTTAYEYGVDDAWIVN
VGDLRPMELPLSYFMDLAYNFEKYGTSNPNNVYEYTEKWVKEQFASEPDITEEDINTITS
LLYDYTWLNGNCKPETLKEGGDTSYSILHYNDAASRLALIDSIIERADGILDKLSESSPA
YTPYYQLVYYPAVASANVVRIQIMYGINNLYAQRRSTLANTYYDLVNKYLKYDEELTEKY
MTLGEDLNGLNKWYGMIITSPDYCKQYKDPVLGNVTAKAHMNYSSWNGESAVKITPQKVE
AEQGAQMIVDIPTEKRAYKAGTATLPDFESTQKQAVVVNLTNGGNEAVDYSITNNDDFII
IEGETSGSYLVSKSFTVKVDWSKVSSDKSGKITVTGGDRTVDIAVNAKAVDTSKAKLTKT
HFMSDGLISIKADDYADKGAKNGISWTVLEGYGKSKTSVKMLETHTKAFKAGEGPWIEYN
FYIPQDGDYKLTVYAGQGNNVSFDEGTHLNAGIQLDGGDINALNIQGEGYVSGVSGGWYA
AIEQGGRRSETALTLTKGEHTLRIWGMDQNLVLQKFVIMPAEENLKPSLIGPEPTYNTSM
GEVEQKQALALIVND

Enzyme Prediction     

No EC number prediction in MGYG000004587_00434.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	196	1013	5.7e-162	0.9440459110473458

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	3.66e-125	354	795	3	333	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	2.18e-40	1080	1254	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
cd04079	CBM6_agarase-like	2.39e-05	1134	1224	42	115	Carbohydrate Binding Module 6 (CBM6); appended mainly to glycoside hydrolase (GH) family 16 alpha- and beta agarases. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family 16 agarases. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the activity of alpha- and beta-agarase catalytic modules which are involved in the hydrolysis of 1,4-beta-D-galactosidic linkages. These CBM6s bind specifically to the non-reducing end of agarose chains, recognizing only the first repeat of the disaccharide, and directing the appended catalytic modules to areas of the plant cell wall attacked by beta-agarases. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. This family includes three tandem CBM6s from the Saccharophagus degradans agarase Aga86E, and three tandem CBM6s from Vibrio sp. strain PO-303 AgaA; in both these proteins these are appended to a GH16 domain. Vibrio AgaA also contains a Big-2-like protein-protein interaction domain. This family also includes two tandem CBM6s from an endo-type beta-agarase from a deep-sea Microbulbifer-like isolate, which are appended to a GH16 domain, and two of three CBM6s of Alteromonas agarilytica AgaA alpha-agarase, which are appended to a GH96 domain.
pfam03648	Glyco_hydro_67N	1.21e-04	231	315	44	119	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).
cd14489	CBM_SBP_bac_1_like	0.002	1134	1224	52	134	Putative Carbohydrate Binding Module (CBM) of extracellular solute-binding protein family 1. Domains in this family co-occur with extracellular solute-binding domains which are periplasmic components of ABC-type sugar transport systems involved in carbohydrate transport and metabolism. Carbohydrate binding modules of family 6 (CBM6), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36) are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of co-occuring (catalytic) modules to their insoluble substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNU66651.1	1.03e-220	194	1256	35	982
AQR97306.1	2.30e-205	197	1253	4	940
AGF58615.1	3.23e-205	197	1253	4	940
AWV33044.1	7.77e-204	199	1259	15	955
AIQ23284.1	9.27e-202	196	1258	5	947

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NPS_A	9.73e-156	216	1256	28	964	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]
4ZMH_A	4.95e-111	197	1255	14	933	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
7PUG_A	1.59e-84	193	957	13	646	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4C90_A	2.06e-84	207	957	54	661	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PXQ_A	3.45e-83	193	957	12	645	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000249	0.998966	0.000206	0.000186	0.000179	0.000167

TMHMM  Annotations     

start	end
5	24
107	129
136	158