CAZyme Information: MGYG000004587_00458

Basic Information

• Species: UBA1409 sp900553675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1409; UBA1409 sp900553675
• CAZyme ID: MGYG000004587_00458
• CAZy Family: CE15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
509	MGYG000004587_3|CGC2	55765.3	4.1604

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004587	2560840	MAG	France	Europe

• Gene Location: Start: 122507; End: 124036 Strand: +

Full Sequence      

MKKIICILLAMAMSLSLFGCSGKTASDGEVTGGSEPETEAKATVDKSGLEALVSEAEGMD
ASAYLNGDYLKKSIESAKAVMENENATETEVNAAMETVNSVIGNLNDGTKFPDPADLKAI
SDIPDPFTFLDGSFVDTPEEWAGRAAELSAMYQHYMYGVWRDGSDEELSYEYADGSLTIK
IKRISTGAETSFKATVMLPDESISAPEGGYPVIVGMHQGISEDTANKNGYATITLDFFGY
PVASDDTKHQGAFYELYPYGDDPAEQTGVLMAWGWGCSKIIDALEAGLGEELNISPENTI
VTGVSRWGKAAAVCGAFEKRFKMVAPSCSGAGGLALYRYTSEGKTYDFSSKGAPSDYKYG
QNEPIGSLQSSAERGWFNDMFLKFKDPEKLPMDQHMLAGLVADDSRYMFIIGSCIYEDWV
NAPAMWYSYLGAKEIFRSLGIEDHIAINIHKEGHAVIPEDIEYMTDYFDYHVYGKEPDHK
LEDLNTSVFALEQNVDKSMDGFTDWWMAP

Enzyme Prediction     

No EC number prediction in MGYG000004587_00458.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	123	472	1.7e-74	0.9851301115241635

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07554	FIVAR	0.002	49	106	3	69	FIVAR domain. This domain is found in a wide variety of contexts, but mostly occurring in cell wall associated proteins. A lack of conserved catalytic residues suggests that it is a binding domain. From context, possible substrates are hyaluronate or fibronectin (personal obs: C Yeats). This is further evidenced by. Possibly the exact substrate is N-acetyl glucosamine. Finding it in the same protein as pfam05089 further supports this proposal. It is found in the C-terminal part of Bacillus sp. Gellan lyase, which is removed during maturation. Some of the proteins it is found in are involved in methicillin resistance. The name FIVAR derives from Found In Various Architectures.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB55348.1	1.05e-165	111	507	369	767
BCS80404.1	1.75e-88	49	492	1423	1857
ADQ41707.1	2.22e-82	56	492	1275	1701
ACI20038.1	5.03e-79	110	470	6	338
QTE69547.1	2.28e-76	108	508	22	439

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7NN3_A	4.76e-79	120	492	21	383	ChainA, Beta-xylanase [Caldicellulosiruptor kristjanssonii I77R1B],7NN3_B Chain B, Beta-xylanase [Caldicellulosiruptor kristjanssonii I77R1B],7NN3_C Chain C, Beta-xylanase [Caldicellulosiruptor kristjanssonii I77R1B],7NN3_D Chain D, Beta-xylanase [Caldicellulosiruptor kristjanssonii I77R1B]
3PIC_A	2.40e-32	112	505	15	369	ChainA, Cip2 [Trichoderma reesei],3PIC_B Chain B, Cip2 [Trichoderma reesei],3PIC_C Chain C, Cip2 [Trichoderma reesei]
6RU2_A	5.16e-27	123	461	18	333	CrystalStructure of Glucuronoyl Esterase from Cerrena unicolor [Cerrena unicolor],6RU2_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor [Cerrena unicolor]
6RV8_A	1.21e-26	123	461	96	411	CrystalStructure of Glucuronoyl Esterase from Cerrena unicolor covalent complex with the aldouronic acid UXXR [Cerrena unicolor],6RV8_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor covalent complex with the aldouronic acid UXXR [Cerrena unicolor]
6RTV_A	1.26e-26	123	461	24	339	CrystalStructure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant [Cerrena unicolor],6RTV_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant [Cerrena unicolor],6RU1_A Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid Um4X [Cerrena unicolor],6RU1_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid Um4X [Cerrena unicolor],6RV7_A Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid UXXR [Cerrena unicolor],6RV7_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid UXXR [Cerrena unicolor],6RV9_A Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid XUXXR [Cerrena unicolor],6RV9_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid XUXXR [Cerrena unicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9RLB8	2.10e-166	111	507	369	767	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1
G0RV93	4.79e-31	112	505	100	454	4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cip2 PE=1 SV=1
D8QLP9	1.54e-27	114	462	25	347	4-O-methyl-glucuronoyl methylesterase OS=Schizophyllum commune (strain H4-8 / FGSC 9210) OX=578458 GN=SCHCODRAFT_238770 PE=1 SV=1
P0CT87	3.35e-26	123	499	111	446	4-O-methyl-glucuronoyl methylesterase 1 OS=Phanerochaete chrysosporium (strain RP-78 / ATCC MYA-4764 / FGSC 9002) OX=273507 GN=e_gw1.18.61.1 PE=1 SV=1
K5XDZ6	4.00e-26	114	509	34	402	4-O-methyl-glucuronoyl methylesterase OS=Phanerochaete carnosa (strain HHB-10118-sp) OX=650164 GN=PHACADRAFT_247750 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000022	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004587_00458.