CAZyme Information: MGYG000004587_01432

Basic Information

• Species: UBA1409 sp900553675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1409; UBA1409 sp900553675
• CAZyme ID: MGYG000004587_01432
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
665	MGYG000004587_12|CGC2	75102.96	5.4342

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004587	2560840	MAG	France	Europe

• Gene Location: Start: 67966; End: 69963 Strand: -

Full Sequence      

MKSDIFEYGKWICPERLAGLTPVDVFDRPESVMGEEPKNVRFYVRKRFNVSKAGIRAHIR
VSADDYYKLYINGSFVGQGPAQGYHTCYYWNEFDVTDFIKDGENEICADVYYQGLINRAY
QSGDRRLGFIAELYFNSDCILHTDSSWESAFIKGCSPSHIIGMNTMFSEDFDGRAGISEW
SSCAEIVTDHVFSPCPAKPLQVYEKEPFAVEQIESGGCLYDFGQEITSTLRISAKGKAGA
KVRILCGEELDESGNVRYDMRCGCLYEEYWTIPEGGGVFEQYDYRGFRYAAVIPQDGVQI
TFVKAIVRHYPFDDSYCELEAASPVLKQVWDICKNGVKYGSQEVFVDCPTREKGQYAGDV
TVTGASHLILTGDTSLLKKAIDNQMQSAKIRQGLLAVAPGSFLQEIADYSLQFPLSALRY
YNAVGDRAYLSENLKVCEGIISHFKKYSRGDGLLCRVMDEWNLVDWPENMRDGYDFPPDY
SAEPHNVINAFYIGCVIGTEQIRDILGVSYKKESPALIKAFNREFYDSETGLYKDRANSS
HISLHSNILPAFYGFIKSGSELAVGDFIVKKGLSCGVYMAYFLLKALCRLGRHTDAYSLI
VSQGEHSWYNMVREGATTCFEAWGKEQKWNTSFCHPWASAPISVLAEDILPKHPELGRIV
YRKSR

Enzyme Prediction     

No EC number prediction in MGYG000004587_01432.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	211	649	3.6e-88	0.8690476190476191
CBM67	37	182	6.6e-26	0.8068181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.28e-32	318	642	5	333	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	9.52e-10	52	182	1	139	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.22e-04	212	301	2	85	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam02837	Glyco_hydro_2_N	8.40e-04	45	111	70	134	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
PRK10340	ebgA	0.001	63	111	135	178	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH20286.1	1.08e-210	11	654	9	676
AYQ75662.1	1.00e-205	22	654	10	652
QCT01521.1	3.01e-205	9	650	7	671
AFH60330.1	9.46e-190	9	654	7	675
AEN95938.1	3.15e-189	10	657	28	697

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	3.41e-21	45	625	180	809	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	2.73e-19	27	623	120	742	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	4.45e-17	56	627	318	901	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
2OKX_A	6.61e-08	57	181	40	164	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	7.88e-34	221	649	610	1072	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2
P9WF03	1.43e-17	43	623	172	781	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	2.42e-16	56	627	318	901	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	2.49e-14	28	628	159	786	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004587_01432.