CAZyme Information: MGYG000004588_01021

Basic Information

• Species: Prevotella sp900317685
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900317685
• CAZyme ID: MGYG000004588_01021
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
779	MGYG000004588_15|CGC1	87367.51	6.4687

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004588	3452051	MAG	France	Europe

• Gene Location: Start: 27299; End: 29638 Strand: -

Full Sequence      

MRRIYVAIFIMLLPIAAMAEKLPYKNPKLSPEERTRDLISRMTLDEKIAQMQCEWLMGKV
RVMTNGKFDEAKAAGRWGNGIGELARLNEDLSITRREQFGQTLSPRRGAKLYNQIQKYFI
EKTRLGIPVVSHEECLHGQQSKDATNFPVPIALASSWDEELIHQIYTAVAKEVRSRGGSH
VLGPVLDVVRDPRWGRTEETMGEDTYYNSRMGKAIVKALQGTEYLIDDEHVGVTLKHFGV
HGNSEGGVNTAPSYMDEHEARQTFLLPFREVIRECDPMYVMVTYNELWGQPAHANSYLLQ
NILRDEFGFKGTIVSDYGGISNIHAVDKSAPDYDEAGIRGLMAGVEMELPDILSYKNLKT
LVAEGRISEQAIDKAVTHILLNKFRLGLFDRPYVDPAKAEQIVGCEAHRKLAYQAAAESM
VLLKNDNRLLPLDKDKVKSIALIGPNANRCILGGYSDVPRDTITPLRAIREKYGDKMNIL
YAEGVRLTNSNDNSHPNVRLLTEQENRQRIREAVKTAEKADVIVLFLGENEAMSREATTA
ETLGDLPTLDLLAGQKQLVDEIVALGKPVCAFVNSGTTLSLGYLEENVPAVMQCWYLGQE
GGYAMIDALFGDVNPSGKLTISFPRSVGHLPSYYNYKPSSRRGYNLGFDISPLHPFGYGL
SYTTYRYSNPRIDRQQMAAGDTAVVSIDVENMGSRDGSEIVQMYVTDDYATMTRPVKELR
GVKRVHLNPGEKQTVSFRIDKDLLSYYDRNNHWQCEPGIFTIAVGASSEDNQKVKLEIK

Enzyme Prediction     

No EC number prediction in MGYG000004588_01021.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	121	350	1.2e-61	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	1	775	1	758	beta-glucosidase BglX.
COG1472	BglX	8.66e-89	42	475	1	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	3.30e-75	23	740	41	743	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	5.90e-69	43	380	1	314	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	3.61e-63	420	662	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEC56332.1	7.18e-317	16	778	17	774
QOY85619.1	9.88e-236	24	778	23	777
QIA09144.1	6.22e-235	24	778	50	799
QBN19183.1	4.03e-234	2	779	3	784
AHG92050.1	1.88e-233	22	778	9	777

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	2.30e-164	24	778	36	784	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	7.04e-129	30	779	6	752	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	3.85e-128	30	779	6	752	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	1.92e-125	107	779	63	751	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	4.40e-121	120	772	65	726	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	6.52e-149	124	779	62	723	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	2.54e-136	24	779	29	755	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
Q56078	3.22e-132	17	768	18	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	3.14e-128	17	778	18	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
A7LXU3	2.34e-101	32	765	36	762	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000302	0.999051	0.000158	0.000150	0.000147	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004588_01021.