CAZyme Information: MGYG000004588_01033

Basic Information

• Species: Prevotella sp900317685
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900317685
• CAZyme ID: MGYG000004588_01033
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
776	MGYG000004588_15|CGC1	88000.83	6.6558

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004588	3452051	MAG	France	Europe

• Gene Location: Start: 50085; End: 52415 Strand: +

Full Sequence      

MRRLLVSLVLLISCYLSGCAQENILLTRQWDASWITVPGIEANAYGVYEFRKICRLEDIP
ASFVVHVTGDNRYKLLVNEQLVSLGPNRSDLAHWNYETVDLAPYLHVGENIVRAVVWNEG
TERAEANMSAQTAFLMKGEGLATVLNTDSSWQCRQDKRYSPKVFKLSKLTYMVTGPGERV
DMNQQPSDWQQAEILSPALPKNAMGGIGGIYSGGIGGVGKYPAWLLTPSILQPREYKEEH
TLNFKTMTVPAHSKKTILLDNKVLTNAYLTMQFSHGKDSHITLSYQESLFTEYPHKGNRN
ETKGKKMIGREDEVISNGQSGQTFTTLTFRTYRFLQLTIETADEPLTIEDIYGHYTSYPF
ELKAKLNTDSKELLNFLTIGWRTAKLCTWETYTDCPYYEQLQYLGDTRIQMLVTLYNVGN
DAFIRNYLTLADASRNVEGLTQSRYPSKTAQYITPYALHYIWSLHDYMMYSGEQRFVTEK
LAGMRAILDYFHRFQKEDGRLSFLPGWNFTDWVDNEKNWAVGVNMPGADGATCVMDLQLL
YAYQMAADLERHLGLQEQARIYENRAALLGRSIEAAYWNEERGLYADRAEKDAYSQHANA
LAIITRLAKGERARAIANALEGDHTLAPASIYFKFYVHQAMTIAGMGDHYLSWLDKWREN
IRMGLTTWAETSDVDGTRSDCHAWGASPNIEIFRTVLGIDSDAPGFKKVRIEPHLGDIHK
IGGEMPHPNGTIKVMYEQNANRLSATIVLPEHTTGTLVWKGKEYVLAAGSNDLKTK

Enzyme Prediction     

No EC number prediction in MGYG000004588_01033.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	253	757	8.7e-110	0.9861111111111112
CBM67	32	193	1.6e-34	0.8806818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	8.94e-22	370	696	9	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.22e-06	698	771	1	75	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	6.56e-04	460	704	344	615	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	0.002	506	621	277	397	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam06202	GDE_C	0.004	457	587	86	220	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE52750.1	5.64e-277	25	771	30	789
QEC69837.1	1.34e-273	25	771	27	792
QMU29042.1	2.66e-270	25	771	30	790
AXE20431.1	5.30e-268	22	771	29	792
AEI46911.1	4.43e-267	22	771	29	793

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.68e-37	322	751	495	933	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	1.22e-24	320	746	261	686	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000006	1.000047	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004588_01033.