CAZyme Information: MGYG000004588_01934

Basic Information

• Species: Prevotella sp900317685
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900317685
• CAZyme ID: MGYG000004588_01934
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
426	MGYG000004588_40|CGC1	49314.62	9.9303

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004588	3452051	MAG	France	Europe

• Gene Location: Start: 10937; End: 12217 Strand: -

Full Sequence      

MNTIKNKYLWMVLIALMPLLPLQAQHHSARKAKAKAATEQKARTLSRIFAVNDYRQKHHA
PEATAFWNVAAYHTGNIEVCKWLTQELGSNKKLSKQRRKQLTEKLNTYLNYSLRWAEHNQ
WKGATEPDTAKWLYKKYGEDQQHVLFGDWQICFQTYIDLYNMYQAQQGSKGQKLTTMEIN
NPAVMTARAREVMGYVVSHPAHDYWWWADALYMVMPVMMKMYKLTGDVRYLDKLYDNICY
SDSIMLDKETGLYFRDGKYIYPMHKTNSGKKDFWARGDGWVLAGLAKVLQDMPKSYRHYD
FFLKKYQRLALAVAQLQQPEGYWTRSMMDPQQAPGPETSGTAFFTYGMEWGVNHGLLNAK
TFRPVIRRAQKYLTTVALQTDGSVGYVQPIGERAIPGQHVDKKSQADFGVGAFLLAATES
LRTQNR

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	104	421	3.3e-67	0.9006024096385542

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.31e-72	51	424	5	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	5.63e-34	151	423	83	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84432.1	1.83e-177	36	422	2	361
QVJ79822.1	1.81e-171	28	426	12	371
ADE82673.1	2.09e-170	28	422	12	367
AGB28481.1	2.34e-169	48	426	31	380
QDW22441.1	9.13e-151	36	422	32	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	3.87e-145	42	422	31	373	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	3.16e-131	35	422	7	356	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	4.64e-47	205	422	152	368	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	9.75e-12	202	419	136	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.94e-11	202	419	126	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	2.99e-46	205	422	159	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	6.19e-44	205	424	157	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	9.77e-41	205	421	199	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	5.34e-11	202	419	136	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002699	0.995144	0.001414	0.000230	0.000236	0.000239

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004588_01934.