CAZyme Information: MGYG000004588_02631

Basic Information

• Species: Prevotella sp900317685
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900317685
• CAZyme ID: MGYG000004588_02631
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
457	MGYG000004588_87|CGC1	51634.01	9.5508

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004588	3452051	MAG	France	Europe

• Gene Location: Start: 2690; End: 4063 Strand: -

Full Sequence      

MIQRFMGRASRWWLLLLCLFFVVTVPACAQDTSNHIYKVKKSDTLYGIAHYHGITVDQLI
NANPEMKLPGCQLHKGDHLYIPTPRNAAATNSDTSTPVAKSSTAKQGKVLRVGVALPLHN
VDGDGKRMVEYYRGILLACDSLKRAGYSIDIHSWNLDATADPTILTRDPAAAQCSIIFGP
LYSVQVHALAEFCKARDIKLVIPFSITGDDVTSYSQIFQIWQSDDKLNNNAIEAFLKRYK
NARVVLIDCNDKTSKKGSFTFGLRNRLSARGQDYRVTNLNSSLEMFGKAFDQNRLNVVVL
NTGRSPELNQAIAKLRTLRAQQHGLRVALFGYNEWLMYAPGNVDTFCSFDTCVPSYYYYN
SVDPRTKALEAEYQKWFHTQPMYAYPRFFLTGYDHAQFFLRGLAKYGKAFKGTAGQSTYR
PFQTPLVFKQVGDKGMQNDNFQLIHFTTGGRIESLTY

Enzyme Prediction     

No EC number prediction in MGYG000004588_02631.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	1.40e-08	36	81	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	3.00e-07	37	82	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
smart00257	LysM	1.58e-05	36	67	1	32	Lysin motif.
COG1388	LysM	0.004	35	95	67	124	LysM repeat [Cell wall/membrane/envelope biogenesis].
PRK10783	mltD	0.005	31	73	398	444	membrane-bound lytic murein transglycosylase D; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB46898.1	5.44e-159	15	457	9	451
ALO48876.1	7.38e-151	21	457	14	448
EFC70285.1	1.17e-143	26	457	19	454
QYR10688.1	2.28e-137	6	457	1	450
QKH88916.1	1.24e-129	6	457	1	463

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.006232	0.848308	0.144465	0.000456	0.000262	0.000256

TMHMM  Annotations     

start	end
12	29