CAZyme Information: MGYG000004589_01654

Basic Information

• Species: UBA2856 sp009696445
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA2856; UBA2856 sp009696445
• CAZyme ID: MGYG000004589_01654
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
598	MGYG000004589_66|CGC1	67739.72	7.9421

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004589	2344590	MAG	France	Europe

• Gene Location: Start: 8552; End: 10348 Strand: +

Full Sequence      

MTGKIQKGLVYLKNRGIREFTARAAEKLADARFDYNRWVRAQEPSPLEMGYQKSLRIGSM
PKIRVMILQQEGEPVRGKAFRRTEETLRRQTYLNAELCDALTTQVSDEDLIVFVRAGDLL
PPHALFELARAILDGSSCVYSDEDRYRLAKDGEREKLMLSDPLFKPDFDPDYLRSVPYIG
SLFGVKAGILRRAAHILRGAAGMPAAELADPAVYYEMTLLCTELSREHVAHVPKILCHAA
GRKEKIVLSQSDAGGKPQDEEAMRRQENQVRDEAFIQVLRRDLSRKGEAGIVERGRGPLC
FHIRYLHPESPLVSLVIPNKDHASMLKRCLDSVCSLTTWERLEIIIVENNSSEPETFSFY
DTLKEGMYRQLPVRVVRYREKGFHFSAIINEGVREAAGDYVVLMNNDVTVKTPDWIERLL
SQCMREKVGAVGPKLLYPDGTVQSAGIVIGIMGFAGSMMVDGKNEDPGYMNRAAAVSRMS
AVTAACMMVSREAFWRAGGFSMEFPVALNDVDFCLRLGEAGYHVLFEPTAELYHHESASR
GYENSREKSKRFENEKRHFRKKWEKTLKEGDPHYNPNLSLRTCHYEINAGVPKWLICG

Enzyme Prediction     

No EC number prediction in MGYG000004589_01654.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	314	495	6.7e-21	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	4.88e-35	316	536	2	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.10e-31	311	568	3	253	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04184	GT2_RfbC_Mx_like	1.17e-24	81	238	18	199	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
pfam00535	Glycos_transf_2	3.71e-19	314	494	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	1.91e-17	316	433	2	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIB58022.1	2.37e-107	5	587	20	604
QMW77454.1	2.37e-107	5	587	20	604
QBE99393.1	3.34e-107	5	587	20	604
QQQ92271.1	1.31e-106	5	587	20	604
QJU15221.1	1.63e-106	5	587	28	612

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.43e-67	111	596	452	904	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	2.31e-55	109	580	403	833	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P9WMY2	8.68e-09	311	541	6	242	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	8.68e-09	311	541	6	242	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
P46370	1.86e-08	308	534	127	329	Uncharacterized 55.3 kDa protein in thcA 5'region OS=Rhodococcus erythropolis OX=1833 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004589_01654.