CAZyme Information: MGYG000004591_00041

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Bulleidia
• CAZyme ID: MGYG000004591_00041
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
724	MGYG000004591_1|CGC1	83711.12	6.2554

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004591	1815806	MAG	France	Europe

• Gene Location: Start: 44846; End: 47020 Strand: -

Full Sequence      

MSIKFRVEIAYSVYKDIEIVGWAIGKRPNTELSFQFCEEDGTVVNYVLRRYHRGDVGELK
TNSTEENHYGFKLRFPFEKKKKYILSITDGKSIVTKKIDSKYILAKRIFKNLIGDRSIFE
ILRKRMRTYQKITYMEWYKKTQATKKELSLQREKKWASDAPKFSIIVPLFKTPDNFLKEL
VSSIQAQTYLNWELCFADGSPTDELKGLVEGFKDERICYHFIGENLGISGNTNKALEMAT
GDWIVLCDHDDLLVPNALYEFADRITKDPEIDSIYSDEDKIDETGKKLFEPHFKPDFNID
MLRSNNYICHLYGVRKELVDRVGKFNSQFDGAQDYDFILRMSENSRKVGHVSKILYHWRT
HINSTAANPESKMYAFKAGAEAIKAHYARVLPNIKIKDVVNGESLGIYHTIFAFEEYPLI
SVIIPNKDHTEDLDKAIRSMMEKGTWPNLEFIVIENNSTEEKTWVYYEKIQKEYPQVKVV
KYNGEFNYSKINNFGVQYATGGYYLFMNNDVELIEPDSLQELMGYAQREDVGAVGCRLLY
EDDTIQHAGVIIGLEGIAGHAFVGQQSHGGTYFNRAMVTQDLSAVTAAVMLVRKEVYEKV
AGFGEDFAVAFNDIDFCLKIRQAGYLVVYAAYGCFHHYESKSRGEDDTSAKMERFQSEIG
LFIEKWEGLLEQGDPYYNPNLSLQSALYSPRNIKYEKIGEPYFNREERERLKKHLSETDD
IVKS

Enzyme Prediction     

No EC number prediction in MGYG000004591_00041.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	164	322	6.1e-25	0.9882352941176471
GT2	421	600	5.6e-20	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.08e-95	161	360	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	9.56e-34	422	639	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06433	GT_2_WfgS_like	4.22e-26	164	365	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.85e-25	418	645	3	227	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	4.79e-22	164	319	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUI96061.1	6.10e-253	4	702	2	725
AYA98637.1	6.27e-251	4	715	2	737
CBL36811.1	2.43e-248	4	702	2	724
CBK76130.1	2.43e-248	4	702	2	724
QRV18616.1	9.53e-241	4	702	2	726

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H7L_A	7.73e-08	161	325	1	178	dTDP-MAGNESIUMCOMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1H7Q_A dTDP-MANGANESE COMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1QG8_A Native (Magnesium-Containing) Spsa From Bacillus Subtilis [Bacillus subtilis],1QGQ_A Udp-manganese Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis],1QGS_A Udp-Magnesium Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis]
3BCV_A	5.45e-06	161	268	5	115	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	7.87e-119	159	691	364	901	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	3.17e-82	158	686	316	836	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	1.01e-13	159	376	6	231	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
Q92IF9	9.32e-12	164	520	17	390	Uncharacterized glycosyltransferase RC0461 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=RC0461 PE=3 SV=1
Q0P9C6	6.45e-09	161	258	2	101	GalNAc(5)-diNAcBac-PP-undecaprenol beta-1,3-glucosyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004591_00041.