CAZyme Information: MGYG000004591_00046

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Bulleidia
• CAZyme ID: MGYG000004591_00046
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
274	MGYG000004591_1|CGC1	32428.04	6.3935

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004591	1815806	MAG	France	Europe

• Gene Location: Start: 53053; End: 53877 Strand: +

Full Sequence      

MISASIVLYNTDKDLLESVLESYHPSQERLLLIIDNSPTPTDYFVNMKYVHYIFNEENIG
FGAAHNIAIHKAIDLKSEYHIVLNPDIEFDTDIIAELKHYCDEHPDVSYVLPKVIYPNGD
LQYLCKLLPTPADLIFRRFIPHFGHHNTHNDRYTLKDSGYNKIFNPPCLSGCFMFLRVST
LEQYQLFFDDRFFMYCEDFDLIRRIHRVAKTIFYPYVTIVHNHAASSYHDIKMLLIHISS
ACKYFNKYGWFFDRERDDFNQRVLSELGLEKEKK

Enzyme Prediction     

No EC number prediction in MGYG000004591_00046.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	1.01e-29	1	254	4	252	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	1.60e-29	6	223	3	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02526	GT2_RfbF_like	5.82e-13	4	241	1	223	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
pfam00535	Glycos_transf_2	3.01e-06	6	149	4	150	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1215	BcsA	0.001	1	230	55	272	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUY18757.1	1.66e-123	1	267	1	270
AGT42710.1	2.03e-115	1	267	1	270
AEE16258.1	5.18e-101	1	267	1	271
AEE17290.1	6.21e-101	2	267	6	277
ALC97477.1	2.46e-95	2	267	3	273

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004591_00046.