CAZyme Information: MGYG000004593_00569

Basic Information

• Species: CAG-194 sp000432915
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-194; CAG-194 sp000432915
• CAZyme ID: MGYG000004593_00569
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
999		112126.93	8.7662

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004593	2619374	MAG	France	Europe

• Gene Location: Start: 86288; End: 89287 Strand: -

Full Sequence      

MSKINLKKVIKYIAIGFTACFAVTSIIAKLKKNTTTYKNEPSQKNPMEGKTVSFVYNEDE
PENADGVRGHLEAIGNSDYKPGFYEKYVKRGIDILLSFGGLVVLSPFLLGISVAIIIDDP
GPVLFTQKRLGKNKEYFKLHKFRSMKMCTPHDVPTHMLDNPEQYITKVGKFLRAHSLDEL
PQIWDIFMGNMSVIGPRPGLWNQDLLTSERDKYQANDVRPGLTGWAQINGRDELEIPDKA
KLDGYYVAHMGLWMDIKVFLGSLHVFGKDDSVVEGGTGEMKKGSAKEKIGRHYTDGQSAQ
ELIGHIGFGDPVEVDTDGKKKVLITGAGSYIGESFIAYAKEKFPALEVEELDMLDGSWRE
KDFSGYDIVYHVAGIAHADVGNVDDETKEKYYAINTDLTVEVCKKAKMDGVKEFIFMSSM
IVYGDSAPYGKKKVIDANTVPAPANFYGDSKLQADVAVRALADDQFKVIVLRPPMIYGKG
SKGNYPILAKLAKKLPIFPDVNNERSMLYIENLCEFLCQIMLVKEIKENAIVLIPQNGEW
TRTSEMVKMIAEVSGKKIKLLKLLKPAVWIGGKVPGKIGELVNKAFGNSCYESQMSNYSG
VKYIKTNLKESLLKTKEIQIEKKALMLASVASMIDLFNEDNINVLLELGYKVDVACNFKE
GSITSNDHVEKYRRSLEKRGIGTYHVPIPRSIYRVRKIIQSYLFVKEMVNNKEYNIVHCH
SPIGGVICRLACIGARRRGTKVIYTAHGFHFFKGASKKAWLIYYPVERICARYTDVLITI
NKEDYARAQKFKAGKVVYVPGIGVHVADIQNIVIDRNEKRKEFGLSDKDFVFMSTGQLSE
RKNHEVVIYALSRIHDETVKYLIVGLGELEGYLKKLAAKLNVSNRVIFAGYREDVYEILH
AVDGFVFPSLQEGLPVALMEAMCVGLPVICSSVRGNIDLVENDKGGLVYDCNDIDGISNG
MKYIASGELSYMGEINKEKVMQFDYSRVQNKMRKLYSNL

Enzyme Prediction     

No EC number prediction in MGYG000004593_00569.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	826	966	1.4e-29	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02397	Bac_transf	1.89e-72	89	260	1	173	Bacterial sugar transferase. This Pfam family represents a conserved region from a number of different bacterial sugar transferases, involved in diverse biosynthesis pathways.
COG2148	WcaJ	9.36e-69	88	272	40	226	Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) [Cell wall/membrane/envelope biogenesis].
cd03808	GT4_CapM-like	3.33e-68	623	992	1	357	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd05232	UDP_G4E_4_SDR_e	5.11e-56	321	611	1	303	UDP-glucose 4 epimerase, subgroup 4, extended (e) SDRs. UDP-glucose 4 epimerase (aka UDP-galactose-4-epimerase), is a homodimeric extended SDR. It catalyzes the NAD-dependent conversion of UDP-galactose to UDP-glucose, the final step in Leloir galactose synthesis. This subgroup is comprised of bacterial proteins, and includes the Staphylococcus aureus capsular polysaccharide Cap5N, which may have a role in the synthesis of UDP-N-acetyl-d-fucosamine. This subgroup has the characteristic active site tetrad and NAD-binding motif of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.
TIGR03025	EPS_sugtrans	2.43e-54	85	260	254	432	exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase. Members of this family are generally found near other genes involved in the biosynthesis of a variety of exopolysaccharides. These proteins consist of two fused domains, an N-terminal hydrophobic domain of generally low conservation and a highly conserved C-terminal sugar transferase domain (pfam02397). Characterized and partially characterized members of this subfamily include Salmonella WbaP (originally RfbP), E. coli WcaJ, Methylobacillus EpsB, Xanthomonas GumD, Vibrio CpsA, Erwinia AmsG, Group B Streptococcus CpsE (originally CpsD), and Streptococcus suis Cps2E. Each of these is believed to act in transferring the sugar from, for instance, UDP-glucose or UDP-galactose, to a lipid carrier such as undecaprenyl phosphate as the first (priming) step in the synthesis of an oligosaccharide "block". This function is encoded in the C-terminal domain. The liposaccharide is believed to be subsequently transferred through a "flippase" function from the cytoplasmic to the periplasmic face of the inner membrane by the N-terminal domain. Certain closely related transferase enzymes, such as Sinorhizobium ExoY and Lactococcus EpsD, lack the N-terminal domain and are not found by this model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31262.1	0.0	1	999	3	1012
QMW80818.1	1.19e-180	59	922	3	950
QIB56408.1	1.19e-180	59	922	3	950
VCV20929.1	9.08e-163	320	999	2	687
APC41948.1	1.08e-144	622	999	2	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W7L_A	4.63e-33	82	286	4	204	Structureof Campylobacter concisus PglC I57M/Q175M variant [Campylobacter concisus 13826],5W7L_B Structure of Campylobacter concisus PglC I57M/Q175M variant [Campylobacter concisus 13826]
2JJM_A	1.08e-13	707	996	93	382	CrystalStructure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_B Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_C Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_D Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_E Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_F Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_G Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_H Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_I Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_J Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_K Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_L Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames]
3MBO_A	1.22e-13	707	996	113	402	CrystalStructure of the Glycosyltransferase BaBshA bound with UDP and L-malate [Bacillus anthracis],3MBO_B Crystal Structure of the Glycosyltransferase BaBshA bound with UDP and L-malate [Bacillus anthracis],3MBO_C Crystal Structure of the Glycosyltransferase BaBshA bound with UDP and L-malate [Bacillus anthracis],3MBO_D Crystal Structure of the Glycosyltransferase BaBshA bound with UDP and L-malate [Bacillus anthracis],3MBO_E Crystal Structure of the Glycosyltransferase BaBshA bound with UDP and L-malate [Bacillus anthracis],3MBO_F Crystal Structure of the Glycosyltransferase BaBshA bound with UDP and L-malate [Bacillus anthracis],3MBO_G Crystal Structure of the Glycosyltransferase BaBshA bound with UDP and L-malate [Bacillus anthracis],3MBO_H Crystal Structure of the Glycosyltransferase BaBshA bound with UDP and L-malate [Bacillus anthracis]
3L01_A	1.22e-11	775	997	190	428	ChainA, GlgA glycogen synthase [Pyrococcus abyssi],3L01_B Chain B, GlgA glycogen synthase [Pyrococcus abyssi]
3FRO_A	1.27e-11	775	997	190	428	Crystalstructure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi],3FRO_B Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi],3FRO_C Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71053	1.36e-55	622	997	3	369	Putative glycosyltransferase EpsD OS=Bacillus subtilis (strain 168) OX=224308 GN=epsD PE=2 SV=1
P10498	1.03e-31	88	263	5	190	Exopolysaccharide production protein PSS OS=Rhizobium leguminosarum bv. phaseoli OX=385 GN=pss PE=3 SV=1
Q0P9D0	2.66e-29	84	275	2	189	Undecaprenyl phosphate N,N'-diacetylbacillosamine 1-phosphate transferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglC PE=1 SV=1
P71241	3.63e-28	86	258	271	449	UDP-glucose:undecaprenyl-phosphate glucose-1-phosphate transferase OS=Escherichia coli (strain K12) OX=83333 GN=wcaJ PE=1 SV=2
B3FN88	7.14e-27	70	258	216	408	UDP-N-acetylgalactosamine-undecaprenyl-phosphate N-acetylgalactosaminephosphotransferase OS=Aeromonas hydrophila OX=644 GN=wecA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.624662	0.159137	0.213035	0.000595	0.000439	0.002134

TMHMM  Annotations     

start	end
10	28
94	116