CAZyme Information: MGYG000004593_01071

Basic Information

• Species: CAG-194 sp000432915
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-194; CAG-194 sp000432915
• CAZyme ID: MGYG000004593_01071
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313		36489.03	4.7316

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004593	2619374	MAG	France	Europe

• Gene Location: Start: 28926; End: 29867 Strand: -

Full Sequence      

MKPVNENATKEAKELLAYLYETAGKKIITGQHTQTNPMEEITYIHEKTGAYPKLQGFELL
GYSPNINYADASEACLTEVKENQGTMDTAIKWAKETDGIVSICFHWFSPMGGRDKSFYSE
HTEFDPEQVLVEGTKERKAFYQDLDVIAGQLARFQQENIPVLWRPFHEVEGTWFWWGRKG
GQVAAELYKLMFDYYVNQKHLDNLLWVWSCPTKEGYPGDAYVDVVSWDIYLPEYEATDYQ
KQYEELIANTSRNKVAALTEVGYNPDVKKLEQSHTPWAYYMTWLKEFCMDGVYNTVEKLK
EMYDSDYSVKRTR

Enzyme Prediction     

No EC number prediction in MGYG000004593_01071.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	4	311	1.4e-95	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	4.29e-45	4	283	1	282	Glycosyl hydrolase family 26.
COG4124	ManB2	1.40e-16	158	264	179	298	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK82137.1	8.96e-162	2	309	3	310
QNM01251.1	1.89e-154	1	309	6	332
AEB13973.1	7.48e-139	1	309	2	308
AOZ93051.1	1.35e-118	3	309	9	315
AZK45707.1	2.84e-117	3	313	6	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	9.84e-58	3	311	6	307	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	5.99e-54	5	307	147	440	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	3.17e-49	3	305	34	343	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	4.30e-44	6	283	48	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	3.10e-42	1	311	21	324	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5AWB7	3.47e-52	2	306	27	342	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
G2Q4H7	3.99e-52	5	307	176	469	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	3.14e-50	5	311	148	454	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	8.47e-43	4	304	29	323	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55296	2.02e-41	4	304	158	450	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004593_01071.