CAZyme Information: MGYG000004593_01361

Basic Information

• Species: CAG-194 sp000432915
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-194; CAG-194 sp000432915
• CAZyme ID: MGYG000004593_01361
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
488	MGYG000004593_17|CGC1	55852.47	4.6505

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004593	2619374	MAG	France	Europe

• Gene Location: Start: 25171; End: 26637 Strand: -

Full Sequence      

MVHNTIQDNEKIKKLEQIHMTRVSHTDSALSFHLMPPSGWLNDPNGLCQLHGTYHIFFQY
SPYSAIGEGDKYWGHYETKDFINYTYTGIFLSPDCDLDKDGVYSGSAFVEDDTMYLYYTG
NTMEDGDFDFTYEGRGSNTTLVTSKDGITASAKKCLLTSADYPHTLSCHVRDPKVFKENG
KYYMVLGARTRNDVGCVLLYEAEDKKHFRFKQYITSEKPFGYMWECPDLFRIDGNRFLSI
SPQGIAAEEYQYQNVYQSGYYRILGDLEDYTLSPFTEWDMGFDFYAPQSFIDESGRRILI
GWMGIGDIEYENPTVAEGWQHTLTVPRELTLDASGDICQNPIKELTALRKEEIIVPSDFF
LTEGAFEMQADITENEDFSIIIDKGMRILYDAASSVFSFSFLPDQECNPEDAKGCGRCIR
KAKIRENKVSSLQILVDHSTIEIFVNNGHYVFSSRYYKTGHAHTVEFSGDMNITAYTLSG
FDCRKQLN

Enzyme Prediction     

No EC number prediction in MGYG000004593_01361.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	33	341	4.4e-88	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	5.20e-157	39	332	1	288	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	2.62e-137	31	457	16	443	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	5.11e-126	1	459	3	460	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	1.17e-104	33	341	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	1.37e-97	33	448	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK74717.1	2.54e-153	32	482	13	459
QEH67471.1	7.93e-149	2	466	1	461
CBL24955.1	1.12e-146	33	469	35	465
ADZ81804.1	1.67e-145	12	457	12	452
BCN29305.1	4.59e-144	10	479	11	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	2.89e-70	31	465	28	466	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
3PIG_A	1.59e-53	32	459	43	487	beta-fructofuranosidasefrom Bifidobacterium longum [Bifidobacterium longum],3PIG_B beta-fructofuranosidase from Bifidobacterium longum [Bifidobacterium longum],3PIJ_A beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum],3PIJ_B beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum]
6NUM_A	2.63e-53	32	459	43	487	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]
7BWB_A	2.82e-53	32	460	52	463	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
6NU7_A	1.08e-52	30	474	34	479	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	6.05e-94	32	478	32	478	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P13394	1.51e-85	10	457	11	453	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
Q05936	2.80e-81	8	484	17	490	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
A1STJ9	4.69e-78	32	475	99	532	Probable sucrose-6-phosphate hydrolase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=Ping_0974 PE=3 SV=1
P16553	1.02e-75	32	478	27	472	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004593_01361.