CAZyme Information: MGYG000004593_01807

Basic Information

• Species: CAG-194 sp000432915
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-194; CAG-194 sp000432915
• CAZyme ID: MGYG000004593_01807
• CAZy Family: GH166
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
280		32561.66	4.263

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004593	2619374	MAG	France	Europe

• Gene Location: Start: 40122; End: 40964 Strand: +

Full Sequence      

MCGKRIKQPVALAVLFVLMFIGGCFLVKANQAKKFEKNDYGVFLNADASSLERFKMYETV
VIDAQYFTKRDIELLHQNGTVVYTYLNIGSIENFREYYTTYAELAIGEYEHWEEEEWVDV
ANPDWQKFIGQLSQELYEKGVDGFFIDNCDVYDYDPHESIFEGITAILQNMMTFGKAVII
NGGDTYVAEYRERYGAIDQIMTGVNQESVWSSIDFDSGTFCEQTSETRDYFCKYLETCKA
DGVEVYLLEYTTNQKLIQKIKEYCKEQDFHCYISSSLELR

Enzyme Prediction     

No EC number prediction in MGYG000004593_01807.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH166	59	275	6.5e-57	0.9776785714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3868	COG3868	1.20e-11	57	277	80	301	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
pfam03537	Glyco_hydro_114	5.75e-09	60	251	20	192	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
COG2342	COG2342	9.73e-09	15	250	2	251	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].
cd06592	GH31_NET37	8.78e-04	118	191	120	191	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
cd14745	GH66	0.007	118	208	134	248	Glycoside Hydrolase Family 66. Glycoside Hydrolase Family 66 contains proteins characterized as cycloisomaltooligosaccharide glucanotransferase (CITase) and dextranases from a variety of bacteria. CITase cyclizes part of a (1-6)-alpha-D-glucan (dextrans) chain by formation of a (1-6)-alpha-D-glucosidic bond. Dextranases catalyze the endohydrolysis of (1-6)-alpha-D-glucosidic linkages in dextran. Some members contain Carbohydrate Binding Module 35 (CBM35) domains, either C-terminal or inserted in the domain or both.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL08521.1	1.39e-102	15	279	21	282
VCV23723.1	2.79e-102	15	279	21	282
CBL11057.1	2.79e-102	15	279	21	282
AOZ95737.1	1.35e-88	4	280	8	286
QHI71547.1	2.24e-81	14	279	6	271

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000160	0.000241	0.999628	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	27