CAZyme Information: MGYG000004594_00535

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; UMGS1663
• CAZyme ID: MGYG000004594_00535
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
610	MGYG000004594_3|CGC2	71568.83	7.7465

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004594	1579058	MAG	France	Europe

• Gene Location: Start: 121179; End: 123011 Strand: +

Full Sequence      

MNVRFQINRAIEFYKKNGFFKTIKKILSKIRNRIFTSSKQIKLDKQENENYKIWIKNNEP
DDKEIEEQRNYKFEYEPKISIIVPMYNTKEKYLKELIDSIINQTYKNWELCLSDGSDEKK
DYVERLVNVDERIKYKFLNANKGISENSNEALKLATGDYIALLDHDDILPAFSLFEVVKT
INTDKEAEFIYTDEDKLLEEKENRMGPHFKQDYAPDTFMSYNYICHFSIFKKNLMERIGG
FRKEFDGSQDYDIIFRATEQANRIIHIPKILYHWRINENSVALSAEAKPYAYEAAKKAIK
AHLNRIGLNANVEDTRIIGLYKVNYEIVGTPKVSIIILNKDHKKDLKRCIDSILEKTTYK
NYEIIIVENNSKTKEIFKYYKELEKNEKIKIVEYKEQGFNYSRLNNFGVKNATGDYIVLL
NNDTEIITKDWIETMVGNCQRKDVGIVGAKLLYENDTVQHVGVVLGLTGVAGHVNLGIGA
DEIGYMGRNIITQNYSAVTGAMLMISKEDYERIGGLDEEFPVAYNDVDLCLKIRKLGKVV
VMNPFVEAYHYESKTRGYEITEEKKRRLEEDTKRLKNKWKDVFEKEDPYFNINFRHDIPA
MRIRTDRVEK

Enzyme Prediction     

No EC number prediction in MGYG000004594_00535.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	80	233	6.4e-26	0.9588235294117647
GT2	334	512	1.1e-22	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	8.51e-103	77	276	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	8.51e-39	335	552	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	8.15e-28	329	557	1	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	4.81e-27	80	280	1	199	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	2.58e-22	80	232	1	161	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE14040.1	3.29e-217	11	597	380	953
AWB09765.1	2.56e-208	7	593	163	749
CDM69534.1	6.09e-206	7	593	186	761
BAV13183.1	1.64e-199	7	593	210	785
ADL50381.1	1.64e-199	7	593	210	785

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.77e-12	79	181	7	109	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	7.11e-08	77	167	5	95	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.58e-121	77	593	366	887	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	8.11e-79	51	556	293	798	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q92IF9	5.19e-16	75	433	12	390	Uncharacterized glycosyltransferase RC0461 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=RC0461 PE=3 SV=1
Q4UM29	9.06e-16	75	433	12	390	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1
Q0P9C6	9.42e-15	77	290	2	217	GalNAc(5)-diNAcBac-PP-undecaprenol beta-1,3-glucosyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004594_00535.