CAZyme Information: MGYG000004596_00633

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-617
• CAZyme ID: MGYG000004596_00633
• CAZy Family: GT0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306	MGYG000004596_18|CGC2	35282.89	7.5341

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004596	2214446	MAG	France	Europe

• Gene Location: Start: 25592; End: 26512 Strand: +

Full Sequence      

METLTPAPILLFVYNRPEHTLHCVESLRANALAAQSPLYVYADAARSEADRPAVDAVRDY
IRTISGFQSVTVIERDHNWGLAANIIDGVTTRVEQYGRVIVLEDDLVVAPHFLEFMNDAL
TVYHDDERVGHVYACEFTGDPALPPTFLVSWIGSWGWATWDRAWRFFNPDGADLLRQLQE
RRLTHRFDFDGAYGFTRMLRHQVQGRNNSWAIRWNATLFLRDMLSVCAGRSLVQNMGFDG
SGTHCGDVAIYTAQLFPNRLSVDHLPIEENQEARAAIARYYRRTNSFRAKAIRRLRREWH
RLWGRK

Enzyme Prediction     

No EC number prediction in MGYG000004596_00633.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02514	GT13_GLCNAC-TI	9.54e-06	6	127	1	129	GT13_GLCNAC-TI is involved in an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. Alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (GLCNAC-T I , GNT-I) transfers N-acetyl-D-glucosamine from UDP to high-mannose glycoprotein N-oligosaccharide, an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. The enzyme is an integral membrane protein localized to the Golgi apparatus. The catalytic domain is located at the C-terminus. These proteins are members of the glycosy transferase family 13.
pfam03071	GNT-I	2.64e-05	6	129	94	225	GNT-I family. Alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (GNT-I, GLCNAC-T I) EC:2.4.1.101 transfers N-acetyl-D-glucosamine from UDP to high-mannose glycoprotein N-oligosaccharide. This is an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. The enzyme is an integral membrane protein localized to the Golgi apparatus, and is probably distributed in all tissues. The catalytic domain is located at the C-terminus.
COG1216	GT2	1.81e-04	9	157	7	145	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	0.006	13	114	6	97	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY36898.1	5.29e-140	7	297	3	294
ATY34291.1	3.04e-84	1	278	1	277
ANV98023.1	1.57e-83	7	282	7	285
ACH39575.1	9.73e-78	8	285	5	282
ABZ94462.1	2.96e-74	7	282	4	280

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004596_00633.