CAZyme Information: MGYG000004596_01116

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-617
• CAZyme ID: MGYG000004596_01116
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
794		85642.93	8.0346

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004596	2214446	MAG	France	Europe

• Gene Location: Start: 1392; End: 3776 Strand: -

Full Sequence      

MINLLSNYKMKKFRAGVLLWAGLSVAVQPLCAQKPLYRDASAPVEVRVRDLLGRMTLEEK
VGQLRCPLGWPMYEKVSVDSVTCSAAFREQMAEAPVGLYWATLRADPWTQKTLRTGLTPA
LAAKALNALQRHAVEQTRLGIPLLFAEECPHGHMAIGATTFPTSLSQASTWNEDLIRRMG
SAIGQEARSQGAHIGYGPVLDIAREPRWSRVEETFGEDPYLTGAMGTAFVRGMQGENVGD
GRHVFSTLKHMAAYGVPRGGHNGNPADMGLRALLDEYLPAFRRAVREGRAVTAMTSYNSI
DGIPCTANGYLLDSLLRRQWGFGGLVFSDLGSIDGMVGARVAENLEAAAVMALTAGTDVD
LGGNAYARLVGAVRQGRVAEACVDSAVARVLRLKFAMGLFENPYVDPETAARIVHSEEHK
ALAREVARQGIVLLKNKGVLPLRKGALKRVAVVGPNADVAYNYLGDYTAPQAPGKVVTLL
DALRERLPGVAVDYAKGCAIRDTTQTDIEAAVRLARQADVVVVAVGGSSARDFRTEYVET
GAATVVQPDGGVLSDMECGEGFDRSTLTLLGDQERLIRAVAATGRPMVVVYIAGRPLDMR
LASDAADALLTAWYPGEQGGHAIVDVLLGAYNPSGRLPLSVPRSVGQLPVYYSQGAQRDY
MDGPGAPLYPFGYGLSYTTFAYSGLKLLPGDGKEVVQVVKCTVKNTGEHDGAEVVQLYLT
DEVSSVQTPPLRLRGFRRVELKRGESRELTFRLTREDLSIHGRDMTFRLEPGRFSVSVGG
SSASRPLSGSFVVE

Enzyme Prediction     

No EC number prediction in MGYG000004596_01116.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	134	361	1.1e-68	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	10	774	1	746	beta-glucosidase BglX.
COG1472	BglX	5.88e-93	55	500	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.69e-89	138	751	78	740	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	9.12e-72	56	393	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	3.12e-64	431	677	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24329.1	0.0	32	794	19	787
QEW35133.1	0.0	11	793	5	785
QQY39447.1	0.0	11	793	7	787
ABR38266.1	0.0	11	793	5	785
ADV43485.1	0.0	23	791	13	779

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	4.81e-139	37	782	36	774	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5YOT_A	5.43e-135	33	794	3	757	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	4.19e-134	33	794	3	757	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
6R5I_A	1.88e-133	48	783	7	723	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	1.03e-132	48	783	7	723	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	4.59e-141	23	791	11	762	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	8.35e-138	23	783	11	755	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	1.94e-123	10	782	1	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
T2KMH0	9.27e-122	106	787	30	715	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
A7LXU3	8.06e-87	10	779	1	762	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.024900	0.795533	0.177585	0.001294	0.000356	0.000295

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004596_01116.