CAZyme Information: MGYG000004596_01496

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-617
• CAZyme ID: MGYG000004596_01496
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401		45122.01	7.4237

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004596	2214446	MAG	France	Europe

• Gene Location: Start: 6454; End: 7659 Strand: -

Full Sequence      

MLLCSACRKEAEPHDNAAFVAVPEPETSTYDLDQIQETGELIVATVSGPDTYYDYHGQIL
GYQYLLATHFAQHIGARLRVELCRDTLELMQTLERGDVDIVAYPLTFTDIGKADLVSCGP
VNASDSTSWAVRHDTPLLAKALRSWYTPGLGKKLTAEERTQQKERSQVRRKVRARYLSRS
QGIISPYDQHFKAAARVTGWDWKLIAAQCYQESGFDPDAVSWAGAQGLMQIMPTTAQHLG
LSPNLVHQPAENIAAAARYIRELSESFREVRDGAERIKFVLAAYNGGYFHIRDAMALCRK
YGKNPTSWLDVSFFVRGLSLPKYYRDPVVKYGYMIGDETYNYVASIMDLWRSYGGTPGRG
VASSSSSLYSSPIRSRKKNRFVRKVEILQPDDEAFNIDEQP

Enzyme Prediction     

No EC number prediction in MGYG000004596_01496.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	198	349	3.4e-27	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	1.28e-73	191	353	1	159	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	9.75e-54	17	353	21	446	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	1.48e-45	17	346	1	424	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
cd13401	Slt70-like	1.06e-23	186	287	5	107	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	1.33e-23	191	304	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH15587.1	4.69e-115	1	381	42	431
BCS86517.1	2.27e-110	26	381	32	388
ALO48082.1	5.34e-109	1	381	15	389
QNT65891.1	9.20e-109	32	377	63	411
EFC70077.2	2.21e-108	32	384	46	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	1.77e-24	187	346	259	414	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OYV_A	1.89e-24	187	346	266	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OWD_A	1.89e-24	187	346	266	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA4_B	2.17e-24	187	346	252	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	2.17e-24	187	346	252	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0KJ50	3.62e-31	27	352	35	452	Membrane-bound lytic murein transglycosylase F OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=mltF PE=3 SV=1
A4SNZ5	1.57e-29	27	352	35	452	Membrane-bound lytic murein transglycosylase F OS=Aeromonas salmonicida (strain A449) OX=382245 GN=mltF PE=3 SV=1
Q0AQY9	1.15e-27	174	348	276	446	Membrane-bound lytic murein transglycosylase F OS=Maricaulis maris (strain MCS10) OX=394221 GN=mltF PE=3 SV=2
B0KRE9	5.24e-27	187	346	289	444	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas putida (strain GB-1) OX=76869 GN=mltF PE=3 SV=1
A5VZC8	1.33e-26	187	346	289	444	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) OX=351746 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000007	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004596_01496.