CAZyme Information: MGYG000004598_00360

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus
• CAZyme ID: MGYG000004598_00360
• CAZy Family: GH48
• CAZyme Description: Cellulose 1,4-beta-cellobiosidase (reducing end) CelS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
840	MGYG000004598_3|CGC1	92281.53	4.1824

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004598	1864052	MAG	France	Europe

• Gene Location: Start: 59302; End: 61824 Strand: +

Full Sequence      

MISKKTKALTAGILSAVMSATAVMPAFTSAANEYATENGANESYAKMFASLYDDVITNGQ
ENGYLSKQNNGGDSFGIPYHSVETLCVEAPDYGHETTSEAMSYIVWVAAMHDILANNGTI
EGSSGDVQKAWKTMEAIIPGWSEASGIKNSINYKSLWNQSRLKADTAYEKDTPQEYPTQN
AGVDAVNPLFNVYKSSYGSDNGYYLMHWLADVDDWYGYGGGTAGAGTGKFTFINTFQRGE
QESCFETVPHPCIEELKYGNNQDGIKGIFNGVGNVSPQYAFTNAPDAEDRAIQAIYFANQ
FGVDCGEISALAGKMGDQCRNDMFDKYYHAIGCQDIMSNGQSGKLGDEGGQHFLMAWYTS
WGGALNNYDWAWQIGCSHSHQFYQNPLAAYALIDDKNINSGMKATGATEDYKESLKRQIE
MYLWLQSVEGPFAGGCTNSYRGRYEKYPDGYPTFYNMVYTPHPVYADPGSNHWIGNQVWP
MQRLTELYYYVKTNGESEAIKGMTFGGLSLEDALKALIERWVVWFEENTHFDYTTEDGTT
MAYAMPSNLDWGSSDTDYSVAPDTWTGTYNPDGNQNLHCEITSYSMGDIGCISSLCNTLI
YYAKAEGVDASCATAEKADGTTAEKGLYLANRLLSAQWNLGRDEIGIAFEDHNGNLKRIF
EEEVYIPSNYHGTMPDGSKLENGATFSSIRQSYANDEMYQAAKAEYDATGSTDGYYYKLH
RFWHHGDALMSYGSMALLYPDVKPLSDDDQPTSGDDGKVTLWGDTNVDGQVTIADAVLIM
QSLANADEYSITAQGQLNGDVVDNGGGITGVDALGIQAYIADLITADQFPLTSDDLSNIS

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH48	44	736	3.1e-207	0.9950900163666121

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02011	Glyco_hydro_48	0.0	44	739	1	620	Glycosyl hydrolase family 48. Members of this family are endoglucanase EC:3.2.1.4 and exoglucanase EC:3.2.1.91 enzymes that cleave cellulose or related substrate.
cd14256	Dockerin_I	1.63e-06	763	821	2	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADX05724.1	0.0	1	785	1	805
CBL17316.1	1.20e-288	1	828	1	801
ADU23081.1	1.36e-252	1	742	1	779
BAJ05814.1	1.36e-252	1	742	1	779
CAS03459.1	5.73e-248	1	760	1	798

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YJ6_A	2.22e-167	43	741	12	636	ChainA, Dockerin type I repeat-containing protein [Acetivibrio thermocellus DSM 1313]
1L1Y_A	2.30e-167	13	742	9	664	ChainA, cellobiohydrolase [Acetivibrio thermocellus],1L1Y_B Chain B, cellobiohydrolase [Acetivibrio thermocellus],1L1Y_C Chain C, cellobiohydrolase [Acetivibrio thermocellus],1L1Y_D Chain D, cellobiohydrolase [Acetivibrio thermocellus],1L1Y_E Chain E, cellobiohydrolase [Acetivibrio thermocellus],1L1Y_F Chain F, cellobiohydrolase [Acetivibrio thermocellus],1L2A_A Chain A, cellobiohydrolase [Acetivibrio thermocellus],1L2A_B Chain B, cellobiohydrolase [Acetivibrio thermocellus],1L2A_C Chain C, cellobiohydrolase [Acetivibrio thermocellus],1L2A_D Chain D, cellobiohydrolase [Acetivibrio thermocellus],1L2A_E Chain E, cellobiohydrolase [Acetivibrio thermocellus],1L2A_F Chain F, cellobiohydrolase [Acetivibrio thermocellus]
6D5D_A	3.07e-161	44	739	20	642	Structureof Caldicellulosiruptor danielii GH48 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii]
4XWL_A	9.12e-158	33	744	37	676	Catalyticdomain of Clostridium Cellulovorans Exgs [Clostridium cellulovorans],4XWM_A Complex structure of catalytic domain of Clostridium Cellulovorans Exgs and Cellobiose [Clostridium cellulovorans],4XWN_A Complex structure of catalytic domain of Clostridium Cellulovorans Exgs and Cellotetraose [Clostridium cellulovorans]
4EL8_A	1.84e-156	44	739	9	631	Theunliganded structure of C.bescii CelA GH48 module [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3DH67	3.25e-169	13	779	9	694	Cellulose 1,4-beta-cellobiosidase (reducing end) CelS OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celS PE=1 SV=1
P0C2S5	3.25e-169	13	779	9	694	Cellulose 1,4-beta-cellobiosidase (reducing end) CelS OS=Acetivibrio thermocellus OX=1515 GN=celS PE=1 SV=1
P37698	1.65e-153	2	793	1	696	Endoglucanase F OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCF PE=1 SV=2
P50900	3.12e-153	41	802	37	714	Exoglucanase-2 OS=Thermoclostridium stercorarium (strain ATCC 35414 / DSM 8532 / NCIMB 11754) OX=1121335 GN=celY PE=1 SV=2
P22534	3.40e-147	76	739	1140	1739	Endoglucanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000252	0.999078	0.000168	0.000199	0.000161	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004598_00360.