CAZyme Information: MGYG000004599_00150

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola
• CAZyme ID: MGYG000004599_00150
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
621		69656.95	5.3329

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004599	3450206	MAG	France	Europe

• Gene Location: Start: 97812; End: 99677 Strand: +

Full Sequence      

MKFRYWICQALVVGAMSSGMAAGEKKQVPIVRNVRIDGYAGNRIDKCIANITMPVDIDLL
VQPFRVQNETQNRWQCEFWGKWVQGAIAYYRYHPDAALYAKIRKSVEMILETQLSDGYMG
NYDKEHQLQGWDVWGRKYTTLGLLKWYGLAGDKKALDAACKLIDYTITQLGPGATSVYTT
GCYKGMASGSILEPVVMLYNATGKVKYLDFAKHLAHSLDELGGPQLITLADTRLDSRFPV
VPDMWWSNDNGQKAYEMMSCYVGLLELYKVTGEERYLDAVEKVVKRIMDEEINICGSGTA
SECWFGGKLRQTEPNCDAMETCVTFSWMQLNERLLEITGTPVYAGNIEKSIFNALFASMK
RDGSEIAKYLPLEGFRMGAIGQCGMPLHCCSANAPRAFAMIPRYVYLTRSGAVDVNLLVP
SSAEVKVGKNVARLTMLTGYPQDGNSEITLECKGKPAFAMRVRIPEWAECADVRVNGVPV
GDVVAGGYTVIDRIWNNGDKVSVSFEMTPWLVMLGNYQAIVRGPITLARDSRFDDGFVDE
ACIIPTDKDGRVELCETAVPEDMWMAYEMEVPVGTYGNDGDMPTRVIHFCDFASACNDWD
FDRRSRVWLPRSVEVRFDSHR

Enzyme Prediction     

No EC number prediction in MGYG000004599_00150.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	72	528	8.9e-53	0.8946322067594433

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	3.33e-61	33	528	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.89e-48	24	528	7	501	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG1331	YyaL	2.99e-06	142	287	419	567	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
COG4225	YesR	0.005	130	278	33	158	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
COG4225	YesR	0.005	195	290	45	114	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	3.85e-171	31	615	24	612
ADY36175.1	1.55e-42	6	529	8	559
BCS34744.1	8.76e-38	81	532	118	574
SCM56172.1	1.27e-36	94	525	112	550
BBI31954.1	8.03e-35	83	535	73	552

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	2.13e-36	81	534	74	554	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	1.68e-28	81	525	81	557	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.92e-26	81	525	81	557	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	4.06e-23	81	547	105	627	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	3.40e-21	81	507	80	536	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.86e-20	81	507	80	536	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001060	0.998137	0.000258	0.000183	0.000171	0.000160

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004599_00150.