CAZyme Information: MGYG000004599_00408

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola
• CAZyme ID: MGYG000004599_00408
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
636	MGYG000004599_6|CGC1	72143.27	5.4169

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004599	3450206	MAG	France	Europe

• Gene Location: Start: 12650; End: 14560 Strand: -

Full Sequence      

MNKSIIKTLTLACLCIAGASCSMKEGTRQNTCQRYQYPCILDISVTPEHGMKRVGCFTDA
GSWMGFTIPQKDKWINGFCGPFSIDNRVWFAQSAVSVNIDGAEFQPDSISYFPGEVYMSA
KSEYGSMEQRMVFASANTALVNIKNNSGEEFSVSGKGWNKDITLKKSNNIITASHPNGET
VQITFPQDFDVICNDSNYTATNNSKNTYVAISFYASENELVSGEQKAISLLNNPEPSIKK
NNDRWEGYLSKVLRTDMKHEYNRVAVKSVVTLISNWRTHREGLLHDGVIPSHAVNYFIGF
WAWDSWRFSAALARFEPELAKNNIRAMFDYQLPDGMIIDCIYTDPAENNARDSKPPLVCW
AVDEILKFNKDTAFVKEMYPQLLSYYKWWFNKRDHNKNGMCEFGCTDGTLEAAGWESGMD
NAIRFDNCKMLKNANDAWSFDQESVDLNAYLAYECKLLRKFADITGYEFDGPDYSDKVAG
YFFNDKMGFFCDRKLPDGKFVQEAACEGYTPFWTRIASQEQMDKALVLLTDTAKFSTYIP
FPTAAADNPKCSPNGYWRGPIWLDQTYQAIKGLRNYGYGELADKYTMQVFDRCEGLTGTS
PIHENYGTHTGECLQAPHFSWSASHLLMLYEDFGKK

Enzyme Prediction     

No EC number prediction in MGYG000004599_00408.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	197	633	1.1e-109	0.5491228070175439

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	2.14e-128	1	636	1	786	alpha-glucosidase; Provisional
COG3408	GDB1	1.27e-14	301	630	285	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	9.08e-08	297	612	125	480	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam03200	Glyco_hydro_63	9.85e-06	370	631	183	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
COG1626	TreA	3.56e-04	413	595	324	511	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37311.1	0.0	1	635	1	638
QUT86878.1	4.21e-313	9	635	8	644
QQY39153.1	8.48e-313	1	635	1	644
AND18792.1	8.48e-313	9	635	8	644
ABR39053.1	8.48e-313	1	635	1	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	2.36e-70	52	636	27	759	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	1.20e-69	52	636	27	759	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	1.66e-69	52	636	27	759	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	1.10e-66	52	636	28	760	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	2.02e-34	52	482	353	838	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	7.04e-70	3	636	4	782	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	1.74e-17	301	624	98	479	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	4.09e-17	301	624	98	479	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
P53008	8.69e-06	372	576	538	762	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000665	0.302307	0.696588	0.000146	0.000137	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004599_00408.