CAZyme Information: MGYG000004599_00495

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola
• CAZyme ID: MGYG000004599_00495
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	MGYG000004599_7|CGC1	42746.79	9.2965

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004599	3450206	MAG	France	Europe

• Gene Location: Start: 55491; End: 56624 Strand: +

Full Sequence      

MKYYLIVGEASGDLHASNIMRSLKKYDENAEFRFFGGDLMQAVGGTLVKHYKDMAYMGFI
PVLLHLRTIFRNMSLCKSDIVEWKPDVLILIDYPGFNLKIAKYIKQHTDIPVYYYISPKI
WAWKEYRIKDIKRDIDKMFSILPFEIEFYKKHDYPICYVGNPSVDSVSAYLDANPYDRES
FIKENGLSDKPIVAILAGSRKQEIKDNLKRMIEVARSFPDYQFVVAGAPGIANEYYRQYI
DTDTTIIFSQTYRLLQHSVAAMVTSGTATLETALFGVPQVVCYYMAAGKLVSFLRKFLLK
VKYISLVNLITGTETVRELVADEMSVSNLKHEFAAILPGGTKRDAILKGYADLKLILGKP
GASEKAAANIVSSLKSK

Enzyme Prediction     

No EC number prediction in MGYG000004599_00495.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	354	1.1e-108	0.980225988700565

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.86e-104	1	377	2	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	5.21e-94	1	371	2	376	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.39e-68	4	367	2	368	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	7.81e-64	5	371	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	8.10e-49	1	374	2	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO23865.1	1.19e-189	1	377	1	377
ADY36062.1	1.57e-186	1	375	1	375
QUT77942.1	1.18e-182	1	375	1	377
QUT69712.1	1.42e-176	1	375	1	377
QUT41873.1	2.02e-176	1	375	1	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.28e-38	5	371	11	378	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.28e-38	5	371	11	378	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.54e-60	5	374	9	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q39T49	8.70e-60	5	377	11	383	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q2LVL8	1.68e-59	5	375	8	379	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	2.36e-59	5	375	11	381	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q74AT9	4.78e-59	5	374	11	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004599_00495.