CAZyme Information: MGYG000004599_02389

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola
• CAZyme ID: MGYG000004599_02389
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286		33000.61	5.1924

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004599	3450206	MAG	France	Europe

• Gene Location: Start: 70; End: 930 Strand: -

Full Sequence      

MDKHFFFIAFIFLPLTVLSRSRVVCDTVRSEILNADRHFSVYLPPSYDNESADKKYPVLY
LLHGMSQTDMDWVYRGHVQEVADRLAYSGEADEMVIVMPDAGGDIYAGVWNGYFDMPGWS
YEKYFFDEFLPYIERKYNILGDKNHRAVAGLSMGGGGATGYGLWHSDMFSSVYAMSALMD
IPEKGAAKFDRPDDKLAILTKTVMERSCIRFVKEADDIILGKLRTVKWFIDCGDDDFLLD
RNIEFFHAMRNAGVECQFRVRDGGHDWEYWHSALYMCLPFVSRNFK

Enzyme Prediction     

No EC number prediction in MGYG000004599_02389.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	30	282	3.9e-57	0.9823788546255506

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00756	Esterase	2.31e-26	30	274	1	239	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	1.33e-24	39	286	37	313	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2382	Fes	1.76e-22	30	274	75	288	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
PLN02442	PLN02442	4.24e-06	15	100	5	84	S-formylglutathione hydrolase
COG2819	YbbA	1.50e-05	37	176	23	169	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APU98448.1	2.77e-32	30	286	47	277
QQT54642.1	2.77e-32	30	286	47	277
QQT29333.1	2.77e-32	30	286	47	277
QRY59864.1	2.77e-32	30	286	47	277
QEH42336.1	6.18e-32	18	283	38	276

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	6.55e-133	20	285	9	272	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
1JJF_A	1.14e-25	18	283	27	259	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	3.07e-25	18	283	27	259	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
6RZN_A	2.03e-21	29	283	138	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
4RGY_A	1.02e-17	25	281	7	261	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	1.61e-23	18	283	46	278	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	1.16e-17	37	284	445	671	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P23553	5.60e-14	59	283	44	263	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
P31471	2.92e-12	18	198	138	325	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EY13	2.68e-10	40	274	517	717	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000219	0.999183	0.000161	0.000135	0.000129	0.000126

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004599_02389.