CAZyme Information: MGYG000004603_00298

Basic Information

• Species: Streptococcus oralis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus oralis
• CAZyme ID: MGYG000004603_00298
• CAZy Family: GH84
• CAZyme Description: Hyaluronoglucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1369	MGYG000004603_2|CGC1	153607.11	5.8563

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004603	1819449	MAG	France	Europe

• Gene Location: Start: 66; End: 4175 Strand: +

Full Sequence      

MLKESQVPVLRNVTVEDYAELKNRGFIEGYYGNPWSNENRKELMRYGSELKLTQYYFAPK
DDPYHNKKWRELYPEEKLAEIRELARVGNQTKTRYVWTIHPFMNNRIRFGNEAHYQADLA
TIKAKFTQLLDVGVREFGVLADDAPSPVGGYHSYVRLMKDITNWLTGKQTTYSGLRKDMI
FVPAWYMGQGTEAELRTLNEHLPENVHLTLTGGKVWGAVDQTFLTNLKKNLTEGGKTYRP
IQFWINWPCNDNTKPHLILGGGEKFLHPNVDLSLAQGIMLNPMQQSEASKVALFDMAQYG
WKQWRSVEEAEQINDMAFNYVVNDHFEESSVSKAFRELGKHMRNQNRPPHVTKLEESVEL
APKLTEFYNKLKSGQNLDTERKELREIFAGLKANALLLKEKGDQKLIEQIHYWLENTVDQ
INALEAFLTATEGLTEKNDAKVWEYYQAGVKHYDQSVKYAFFYVDHYEYAEFGVQHIRPF
INNLKEYLALHIQAMLNPDKFVTTFITNRAGIEGGLKEVTDGDFDTHVIAKTTIVIERGD
YVGLRFNKAIKIHKLGFATGTNTADNYTFSNALVEYQNKHGEWVAITSPAYTGRERILEF
NDLDITAQAVRMIATAKKDNAWLAMREIAVNRPLELDSKKVRGTISLSPNLVYKYGTSVV
QMQDGRENTESMMAHVDQTNVTPAQAWVKMDLGGLHKVKRVHLMQGERDKLASGVIEYSA
DGTNWTTLQNLSGQRTSDIVKEFTTRFVRIRNTQTLNKWWRIAEFTVDVDSPNLDLTDTN
VDALKETPVVDSLGSYELQIPAGTKLPAHSYLGMKLDRIHQIKSIQLQGQANPALSLEYS
ANAQEWMPASQLTDRSAASHLVRYVRLVNKTDQEQAITATSLLVTTKEVQPTKLESTTMG
IHPTYGSNDVRKLNNLDQLFDGVYNNFVEFSDYAHKDGHVTLKLGSERTIKKIRAYIQDG
TQNYLRDGKIQVSQDGKTWTDVVTVGDGVANSTHDDSLTDGWTHDSKMPGNRYIEGELTT
PVKANYLRVLYTADYDARFVGFTELVINDGEFVKPINDPTVEGSSGESQGNLYNNLVDGK
VLTSYKSEKDKGELVYHLSEPTKANHLRLVSSLPEGAKARILARTLKDGQDSWTDLGAIT
SSLQTFAIRNGGSLLDVKLVWEGGKAEFYELASFHQELTEEPVQSSKGEEPAPVLEVPEF
TGGVNAVEALVHELPEYTGALATVGDQAAPTVEKPEFKGGVNAVEALVHELPEYTGPVAT
VGDQAAPTVEKPEFKGGVNAVEALVHELPEYTGPVATVGDQAAPTVEKPEFKLSSLEKTQ
TSGAPVQIAKEDKRLPETGEKQSETAIFLASVGLALSAIFVAKSKKEIN

Enzyme Prediction     

EC	3.2.1.35	3.2.1.52

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	24	336	6.5e-95	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	9.88e-101	24	338	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam00754	F5_F8_type_C	2.79e-08	682	765	31	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	1.02e-06	687	753	47	129	Substituted updates: Jan 31, 2002
pfam00754	F5_F8_type_C	3.12e-06	919	1029	17	110	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	3.42e-04	940	1037	48	134	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQA08903.1	0.0	1	1369	302	1670
QQQ35904.1	0.0	1	1367	302	1705
VEF78372.1	0.0	1	1367	1378	2749
CBZ01293.1	0.0	1	1367	1378	2751
BAV80455.1	0.0	1	1367	1378	2751

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PV4_A	1.54e-157	10	497	166	653	Structureof CpGH84A [Clostridium perfringens ATCC 13124],6PV4_B Structure of CpGH84A [Clostridium perfringens ATCC 13124],6PV4_C Structure of CpGH84A [Clostridium perfringens ATCC 13124],6PV4_D Structure of CpGH84A [Clostridium perfringens ATCC 13124]
6PWI_A	1.19e-84	10	486	166	622	Structureof CpGH84D [Clostridium perfringens ATCC 13124],6PWI_B Structure of CpGH84D [Clostridium perfringens ATCC 13124]
5MI4_A	1.46e-42	1	436	121	532	BtGH84mutant with covalent modification by MA3 [Bacteroides thetaiotaomicron VPI-5482],5MI5_A BtGH84 mutant with covalent modification by MA3 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],5MI6_A BtGH84 mutant with covalent modification by MA3 in complex with Thiamet G [Bacteroides thetaiotaomicron VPI-5482],5MI7_A BtGH84 mutant with covalent modification by MA4 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482]
2J4G_A	4.12e-42	1	436	109	520	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	4.16e-42	1	436	110	521	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26831	2.51e-248	10	1186	173	1362	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q89ZI2	2.76e-41	1	436	131	542	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	2.12e-35	1	418	162	559	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	2.12e-35	1	418	162	559	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
O60502	4.67e-21	25	297	63	329	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004603_00298.