CAZyme Information: MGYG000004603_00840

Basic Information

• Species: Streptococcus oralis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus oralis
• CAZyme ID: MGYG000004603_00840
• CAZy Family: GH84
• CAZyme Description: Hyaluronoglucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1367		151992.12	5.4669

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004603	1819449	MAG	France	Europe

• Gene Location: Start: 66; End: 4169 Strand: +

Full Sequence      

MLKESQVPVLRNVTVEDYAELKNRGFIEGYYGNPWSNADRAELMRYGGDLKLNQYFFAPK
DDPYHNKKWRELYPEEKLAEIRELARVGNQSKTRYVWTIHPFMNNRIRFGNEAHYQEDLA
TIKAKFTQLMKVGVREFGILADDAPSPVGGYNSYNRLMQDMTKWLTEMQGTYSGLRKEMI
FVPGQYWGNGREDELKSLNENLPSSTSMTLTGGKIWGEVSESFLSTLKNNLSAGGKTYRP
VSLWINWPVTDNSKQHLILGGGEKFLHPNVDPSLLSGIMLNPMQQSEPSKIALFSGAQYS
WKQWKSEEEAKKINDIAFNFVENGHFEDSKVSAAFRELGKHMINQNMDNRVVKLEESVDL
APKLTDFMTKLKAGQDVTAERAALRAEFAKIKEAAELYKASGDKKMVAQIHYWLDNAIDQ
MNALDAFLTGTEAMATNDAAKLWDSYYKGLKLYEQSQTHTFHYVDHMERAELGVQHIRPF
ILSLKEVLASEVQKVLHPDQIISTFITNRTGVEGGLAEVTDGDLATHAIIKSPNSIKTGD
YIGMKFNKPVAIQTLTFAMGTQANPRDTFSKAEVQYLDENDNWVTLKEPSYVGNESLLKF
ENLNIKAKAVRMIATADRENTWFAVQEIAVNRPVEKARSQQATTVSLSSNLVYKLNTSAR
QITDGKDNTEAMMANADGSNTTPVDAWAQLDLGEVKSVTKVRLRQGTGDKLAAGVLEYST
DGTTWQELDRLAGEQTKEVTRAINARYIRVRNTKALDLWWRIQDFSVETRSGNSELTDTN
VDALKETPVVDSLGSYELQIPAGTKLPAHSYLGMKLNRIHQIKSIQLKGQANPALTLEYS
ANAQEWTLASQLTDRSVVSHLVRYVRLVNKTDQEQAVTATSLLVTTKEVQPTKLESTTMG
IHPTYGSNDVRKLNNLDQLFDGVYNNFVEFSDYAHKDGHVTLKLGSERTIKKIRAYIQDG
TQNYLRDGKIQVSQDGKTWTDVVTVGDGVANSQHDDSLTDGWTHDSKMPGNRYIEGELTT
PVKANYLRVLYTADYDARFVGFTELVINDGEFVKPINDPTVEGNGGESQGNFYNNLVDGK
VLTSYKSEKEKGELVYHLSEPTNANHLRLVSSLPEGAKARVLARTLKDGQDSWLDLGAIT
SSLQTFAIRNGGSLLDVKLVWEGGKAEFYELASFHQELTEEPVQSSKGEEPAPVLEVPEF
TGGVNAVEALVHELPEYTGAVATVGDQAAPTVEKPEFKGGVNAVMALVHELPEYTGPLAT
VGDQAAPTVEKPEFKGGVNAVMALVHELPEYTGPLSTVGDQAAPTVEKPEFKLSSLEKTQ
TSGAPVQIAKEDKRLPETGEKQSETAIFLASVGLALSAIFVAKTKKD

Enzyme Prediction     

EC	3.2.1.35	3.2.1.52

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	24	335	6e-97	0.9796610169491525

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	1.07e-101	24	301	1	263	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam00754	F5_F8_type_C	2.82e-09	641	754	1	114	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam00754	F5_F8_type_C	4.81e-06	919	1029	17	110	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	4.05e-05	687	753	47	129	Substituted updates: Jan 31, 2002
cd00057	FA58C	2.00e-04	940	1037	48	134	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEF78372.1	0.0	1	1367	1378	2749
QXW61150.1	0.0	1	1367	1378	2751
QLL96371.1	0.0	1	1367	1378	2749
QQK99918.1	0.0	1	1367	1378	2751
QRO07659.1	0.0	1	1367	1378	2751

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PV4_A	3.13e-162	10	489	166	645	Structureof CpGH84A [Clostridium perfringens ATCC 13124],6PV4_B Structure of CpGH84A [Clostridium perfringens ATCC 13124],6PV4_C Structure of CpGH84A [Clostridium perfringens ATCC 13124],6PV4_D Structure of CpGH84A [Clostridium perfringens ATCC 13124]
6PWI_A	1.25e-82	10	488	166	624	Structureof CpGH84D [Clostridium perfringens ATCC 13124],6PWI_B Structure of CpGH84D [Clostridium perfringens ATCC 13124]
5MI4_A	1.90e-46	1	414	121	510	BtGH84mutant with covalent modification by MA3 [Bacteroides thetaiotaomicron VPI-5482],5MI5_A BtGH84 mutant with covalent modification by MA3 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],5MI6_A BtGH84 mutant with covalent modification by MA3 in complex with Thiamet G [Bacteroides thetaiotaomicron VPI-5482],5MI7_A BtGH84 mutant with covalent modification by MA4 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482]
2J4G_A	5.30e-46	1	414	109	498	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	5.36e-46	1	414	110	499	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26831	9.09e-271	10	1186	173	1362	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q89ZI2	3.67e-45	1	414	131	520	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q8XL08	1.33e-42	1	649	162	783	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q0TR53	9.29e-42	1	615	162	744	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
O60502	6.33e-19	25	299	63	331	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004603_00840.