CAZyme Information: MGYG000004603_01057

Basic Information

• Species: Streptococcus oralis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus oralis
• CAZyme ID: MGYG000004603_01057
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	MGYG000004603_4|CGC4	39277.13	6.3708

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004603	1819449	MAG	France	Europe

• Gene Location: Start: 235650; End: 236708 Strand: +

Full Sequence      

MKKIVFTGGGTVGHVTLNLLLMPKFIEDGWEVHYIGDKHGIEHQEILKSGLNVTFHSIAT
GKLRRYFSWQNMLDVFKVGWGIVQSLFIMLRLRPQALFSKGGFVSVPPVIAARVSGVPVF
IHESDLSMGLANKIAYKFATKMYSTFEQAAGLAKVEHVGAVTKVSDQNTPEPDELVDIQT
HFDPKLPTVLFVGGSAGARVFNQLVTDHKQELTERYNIINLTGDSSLNELSQNLFRVDYV
TDLYQPLMEMADVVVTRGGANTIFELLAMAKLHLIVPLGREASRGDQIENAAYFVKKGYA
EELQESDLTLENLEDKLSHLLSHKDQYQASMKASTELKSLADFYDLLRKDLA

Enzyme Prediction     

No EC number prediction in MGYG000004603_01057.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	188	338	2.6e-33	0.9681528662420382

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	1.67e-141	1	352	1	353	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
COG0707	MurG	1.52e-112	2	352	1	353	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK12446	PRK12446	3.48e-95	1	332	1	334	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
cd03785	GT28_MurG	4.76e-84	3	333	1	333	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	5.22e-68	2	347	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXW60949.1	5.00e-252	1	352	1	352
AQA08608.1	5.00e-252	1	352	1	352
QCZ58101.1	1.43e-251	1	352	1	352
QQK99707.1	5.83e-251	1	352	1	352
QRO07431.1	5.83e-251	1	352	1	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1F0K_A	5.48e-25	2	318	7	320	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	6.41e-23	3	323	4	324	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	6.15e-20	2	349	10	364	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1IAM4	5.45e-241	1	352	1	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus pneumoniae (strain Hungary19A-6) OX=487214 GN=murG PE=3 SV=1
P0CB60	1.56e-240	1	352	1	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=murG PE=3 SV=1
B2IN77	3.15e-240	1	352	1	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus pneumoniae (strain CGSP14) OX=516950 GN=murG PE=3 SV=1
C1C649	3.67e-239	1	352	1	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus pneumoniae (strain 70585) OX=488221 GN=murG PE=3 SV=1
Q8DQM1	7.41e-239	1	352	1	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004603_01057.