CAZyme Information: MGYG000004604_01450

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae
• CAZyme ID: MGYG000004604_01450
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365		41449.32	4.1518

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004604	1899117	MAG	France	Europe

• Gene Location: Start: 49; End: 1146 Strand: +

Full Sequence      

MAKGQTVTVLETMEKWSRVATEDGCIGYIENRRLEEPSVIEFTGNFTEPVYESTRLEEKI
VLGWHQVTSPEANGQLEQVVSAAEGLNVIAPTWFSLTDNEGNYRSLADREYVEKAHEMGL
QVWALLDNFSNQVQTEVLLSSTSTRRKLINSLIADAAAYDLDGLNMDFEGIKEEAGVHYI
QFLRELSIACREEGLILSVDNYVPTASNQFYDRKEQGIVADYVIVMGYDEHYAGGEPGSV
ASLEFVRSGIENMLKDVPKEKLINGVPFYTRLWTETLEGVESKALGISAAKKWIEENDVE
LYWQEPLGQYYGEHQTEDGIQYLWMEEEDSLREKMDLIREHDLAGVACWKLGLEDAAAWD
SIRWQ

Enzyme Prediction     

No EC number prediction in MGYG000004604_01450.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	98	354	6.4e-36	0.7837837837837838

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	2.33e-76	68	362	8	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	1.34e-46	6	363	64	419	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	1.10e-28	86	359	24	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
smart00636	Glyco_18	1.17e-27	123	353	76	333	Glyco_18 domain.
pfam00704	Glyco_hydro_18	3.61e-24	123	352	73	305	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV18839.1	3.09e-168	1	363	186	549
ADL02970.1	3.09e-168	1	363	186	549
SEU04925.1	1.34e-164	1	363	186	549
ANU47709.1	1.67e-159	2	362	191	556
QQR03393.1	1.67e-159	2	362	191	556

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3K_A	2.88e-22	62	359	110	420	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
3CZ8_A	3.49e-21	129	355	81	312	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4S3J_A	8.12e-21	128	359	180	418	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
6LE8_A	7.15e-09	140	355	99	349	ChainA, Probable endochitinase [Caenorhabditis elegans]
6LE7_A	1.27e-08	140	355	98	348	ChainA, Probable endochitinase [Caenorhabditis elegans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37531	4.77e-25	125	359	169	416	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
O32258	2.04e-24	86	363	52	340	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
O05495	2.20e-20	129	353	173	402	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P0DPJ9	1.47e-19	128	359	179	417	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	9.04e-19	128	359	179	417	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004604_01450.