CAZyme Information: MGYG000004605_00665

Basic Information

• Species: UBA7173 sp900555165
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp900555165
• CAZyme ID: MGYG000004605_00665
• CAZy Family: GH97
• CAZyme Description: Glucan 1,4-alpha-glucosidase SusB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
694	MGYG000004605_7|CGC2	77514.41	6.108

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004605	2767428	MAG	France	Europe

• Gene Location: Start: 16441; End: 18525 Strand: +

Full Sequence      

MVPRLVAGHRPGKRITTKILPVKKLAILSISAVAAAGLGAFLHSCIGASAGNLAETSPDG
RISLNVGVTPQGRVFYTLATPERTVLDTSYVAIEMREGAIGRRSKVKNVSHSSFDETWTQ
VQGEEAQVRNNYNEIRIDLTEEGSAVKEYSLVFRVFDDGVGFRYEVPAQEGVDSLTIMDE
HTQFNMAEDAVAWSIPWDHEYYEHLYEPSPVSKIDTVCTPVTIKVTDDLYLAIHEADLQD
YASLNLVADSSSTTLHSYLTPWSTGEKVFKKAPFNTPWRTVIVAKSPGDLALSRLMLNLN
EPCKIEDTSWIKPGRYVGIWWGMHMKDFTWCSGPKHGATTENAKRYIDFAAEHGYSGVLV
EGWNRGWDGDWTKNGDIISYTEPYPDFDLEEVCRYAREKGTRLIGHNETAGGVRNYEAQM
DSAFALYHRLGINTVKTGYVNLLLDGKELHGSQYGVRHYRKVVETAAKHHIMIVNHEGVM
PTGWRRTYPNLLSHEDMRGQEYDAWSPDGGNPPEHTCMLPFTRGLAGPMDFTPGTFNYDN
PGLPTTHPQTTIAKQLALAVVLYTPSVMSSDKVENYVGRPEFEFLKRCPCNWEKTLYPEA
SIGEYVTVARKNRGGDDWYIGSITNARPHNVEVKLDFLDPDKKYVARIFADGEKADYRTN
PYPVDIKDVEVKAGDTLPLHLAPGGGSAVILTCR

Enzyme Prediction     

No EC number prediction in MGYG000004605_00665.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	50	691	6.2e-223	0.9809825673534073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	7.07e-135	307	589	1	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	5.93e-82	57	302	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	1.05e-40	592	692	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK53954.1	3.28e-294	42	691	15	661
QIK59403.1	3.79e-293	42	691	15	661
CCO21768.1	3.07e-285	56	692	27	663
CCO21489.1	3.07e-285	56	692	27	663
CCO21728.1	3.07e-285	56	692	27	663

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HQ4_A	4.29e-193	57	689	5	656	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQC_A	6.07e-193	57	689	5	656	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	1.22e-192	57	689	5	656	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
3WFA_A	9.39e-164	56	689	6	701	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	9.67e-164	56	689	15	710	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G8JZS4	7.38e-163	56	689	26	721	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
Q8A6L0	1.06e-70	57	689	27	659	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	9.69e-47	51	690	39	619	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.566821	0.225808	0.202109	0.000983	0.001102	0.003179

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004605_00665.