CAZyme Information: MGYG000004609_01716

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter
• CAZyme ID: MGYG000004609_01716
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
818		90495.85	4.1477

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004609	2469643	MAG	France	Europe

• Gene Location: Start: 231; End: 2687 Strand: +

Full Sequence      

MARDLEYLKVMDADRMLYNFRDAFGQDTKGADPLTGWEEPTGLLRGHSTGHFLSALAQAY
ASTGESAYKDKMDYMVSELHKLQQLSKGNPEDFETKCSPTNAAQNLWSTDPNTWGEGFLS
AYSPDQFALLEQYTPYNTIWAPYYTLHKITAGMIDCYQYGGNEEALEVAKGIGTWIYRRL
SGCTDEAQREQMWAMYIAGEYGGMNESLARLYEITGEEKFMEAAKMFDHKSWFADLAANI
DVVQNKHANQHIPRIVGAIHEYAATGDVSYYNTAYNFWNIVTQRYAYSIGGVGTGEMFKD
PYQQGNNILGNTGRGENCETCAAYNMLKLTKDLYNYDPDNAEYMDYYERTLINQIAASQS
HDTTEWMHNGTTYMLPIDPGQRRDYDSDYGGFTCCNGTGMENHVKYQAAAYAKTDDTLYV
NLYMPTTVTWDEMGVSVKQETNFPSEHSKLTVNGSGDFTMKLRVPYWATAGFEVKVNDET
ICTNPEVSTYVEIDRAWSDGDVVEITMPYTLHLDKTPDKVDGSTVASLMYGPLVMVAKDD
RDTYVPMNWYTVVLSENLEDSVEVVTGPDAEDGSVPHLVTNGLHFYPMYDAYNYRYHAYV
KVEETQSVVNKDELQALVDSAADALQENYGEEEWAALQQAIADAQAVLDNAEATQVDVYN
AYKALEAALANTIVPPADKSELQEAVDNALADSEKDKYTAESWQAYQEALANAQAVLADV
NATQEDIDAALAALQQAEDALVPVSGTEDPGTKPGTDDPDNKPGAGGDDGKDSGTDSKDN
GPSKAAQTGDTTPITAMAALLVVSAAMAGTVIYRKKRG

Enzyme Prediction     

No EC number prediction in MGYG000004609_01716.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	2	535	4.2e-181	0.9701789264413518

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	3.72e-138	1	534	13	501	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	6.19e-79	6	549	28	517	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07554	FIVAR	2.38e-05	680	728	1	55	FIVAR domain. This domain is found in a wide variety of contexts, but mostly occurring in cell wall associated proteins. A lack of conserved catalytic residues suggests that it is a binding domain. From context, possible substrates are hyaluronate or fibronectin (personal obs: C Yeats). This is further evidenced by. Possibly the exact substrate is N-acetyl glucosamine. Finding it in the same protein as pfam05089 further supports this proposal. It is found in the C-terminal part of Bacillus sp. Gellan lyase, which is removed during maturation. Some of the proteins it is found in are involved in methicillin resistance. The name FIVAR derives from Found In Various Architectures.
TIGR04320	Surf_Exclu_PgrA	3.65e-05	635	726	264	350	SEC10/PgrA surface exclusion domain. This model describes a conserved domain found in surface proteins of a number of Firmutes. Many members have LPXTG C-terminal anchoring motifs and a substantial number have the KxYKxGKxW putative sorting signal at the N-terminus. The tetracycline resistance plasmid pCF10 in Enterococcus faecalis promotes conjugal plasmid transfer in response to sex pheromones, but PgrA/Sec10 encoded by that plasmid, a member of this family, specifically inhibits the ability of cells to receive homologous plasmids. The phenomenon is called surface exclusion.
pfam07554	FIVAR	3.87e-04	613	671	2	67	FIVAR domain. This domain is found in a wide variety of contexts, but mostly occurring in cell wall associated proteins. A lack of conserved catalytic residues suggests that it is a binding domain. From context, possible substrates are hyaluronate or fibronectin (personal obs: C Yeats). This is further evidenced by. Possibly the exact substrate is N-acetyl glucosamine. Finding it in the same protein as pfam05089 further supports this proposal. It is found in the C-terminal part of Bacillus sp. Gellan lyase, which is removed during maturation. Some of the proteins it is found in are involved in methicillin resistance. The name FIVAR derives from Found In Various Architectures.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF45278.1	4.89e-243	2	602	548	1138
AKA69367.1	6.36e-170	3	604	661	1215
AWI04506.1	1.25e-169	3	604	661	1215
AET60941.1	7.06e-151	1	602	211	765
ASR47498.1	1.19e-149	1	602	211	765

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	2.93e-81	4	601	47	649	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	3.62e-78	4	535	47	559	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	1.54e-26	124	557	123	563	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
5MQO_A	1.50e-16	152	507	247	577	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
791	813