CAZyme Information: MGYG000004611_00156

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus
• CAZyme ID: MGYG000004611_00156
• CAZy Family: GT9
• CAZyme Description: ADP-heptose--LPS heptosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340		37929.21	8.4917

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004611	1855749	MAG	France	Europe

• Gene Location: Start: 12661; End: 13683 Strand: -

Full Sequence      

MIDLDGKRIIVTFLMHLGDLVLTTPFLCALRKAAPHAEITYLVDEKLKDIVAYNPHIDHV
WTLDKKGKDDNLPALWQMSRRISAANFDVLLNLHPNERCSFIDAAARVPVKAGASHFLFR
GFFHPFLKLNRKLHAADMYLDVLTRLGVKKLEHNGLEVFPGPEHKAGADAFWTQAGLQKE
EKLIGFNIGSAVVTKRWAPKRFAQVADTLAKEGYRTVFFGGTMDEAMVKEAVGFMQSRPI
VATGQFSLGELAAAMSRCCLIITNDSGPMHVAISQKVPIVAMYGPSHPELYGPYTKQATI
VRAIPPCDGCRKGMKHHCDDLRCMRDLTVEQVLEAAHQWL

Enzyme Prediction     

No EC number prediction in MGYG000004611_00156.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	76	318	6.2e-50	0.9511111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	5.88e-72	8	338	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	3.22e-56	7	340	2	330	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	5.18e-32	80	312	6	238	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02195	heptsyl_trn_II	3.45e-31	18	340	11	333	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10422	PRK10422	3.14e-20	7	295	6	300	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADB48007.1	2.25e-211	1	340	1	340
AEQ22076.1	3.76e-191	1	340	1	340
QTV78222.1	1.49e-173	2	340	5	343
QNP77239.1	2.53e-168	1	340	1	340
BBG62449.1	4.18e-167	1	340	1	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	5.28e-105	3	340	5	345	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
1PSW_A	1.56e-17	173	334	172	337	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]
2GT1_A	1.23e-06	8	303	2	299	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	1.23e-06	8	303	2	299	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	1.27e-06	8	303	2	299	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37421	2.38e-19	177	340	176	343	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1
P37692	5.34e-18	173	334	172	337	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P45042	9.71e-18	171	340	170	344	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
P25742	6.06e-17	18	296	5	289	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q9R9D5	7.94e-17	18	295	5	288	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004611_00156.