CAZyme Information: MGYG000004612_00162

Basic Information

• Species: UMGS363 sp900768245
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS363; UMGS363 sp900768245
• CAZyme ID: MGYG000004612_00162
• CAZy Family: CE2
• CAZyme Description: Cellulase/esterase CelE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349	MGYG000004612_2|CGC1	39070.03	4.7936

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004612	2741718	MAG	France	Europe

• Gene Location: Start: 73438; End: 74487 Strand: -

Full Sequence      

MFFLPDNEKINYMGRIEFSDPKAPVFYFAGSQILFDFSGTSLKIKLNNHTVWGEVSLGAI
IDGEMIKVQLQAENNDKDMTLTVAENLAAGKHTAVIYKKHAGNQFFVFKGIEADGLLEKP
ELPSFKVEAYGDSVCAGEVIEAADYVGKCDPEGHNSRYDNVWNSFVMQTARNLGGQIHNI
CQGGIALFNGTGYFHSPDYIGLETTYDKLCYFPEGGELTPWDFKRYIPDLVIIAIGQNDK
HNGITDSDDIDIADPAYREKWKTAYKKFVLDLNEKYGSPKFVLTTTVLMHDAEWDKAIDE
IKDELNAAGVKAYHNLFTRNGAATPGHPRLAEHNEMAEELTAFIRQNVL

Enzyme Prediction     

No EC number prediction in MGYG000004612_00162.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	126	344	2e-50	0.9952153110047847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17996	CE2_N	2.11e-22	12	120	1	108	Carbohydrate esterase 2 N-terminal. This is the N-terminal beta-sheet domain with jelly roll topology found in CE2 acetyl-esterase from the bacterium Clostridium thermocellum. This enzyme displays dual activities, it catalyses the deacetylation of plant polysaccharides and also potentiates the activity of its appended cellulase catalytic module through its noncatalytic cellulose binding function. This N-terminal jelly-roll domain appears to extend the substrate/cellulose binding cleft of the catalytic domain in C.thermocellum.
cd01831	Endoglucanase_E_like	2.01e-10	126	345	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
cd01834	SGNH_hydrolase_like_2	5.57e-05	222	340	56	188	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
pfam00657	Lipase_GDSL	0.004	228	286	79	135	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO05720.1	3.67e-128	6	344	11	347
ADU20683.1	2.42e-117	8	344	16	351
CBK95802.1	9.24e-93	5	344	9	340
CBL12376.1	5.15e-91	1	344	37	375
CBL34143.1	1.69e-90	5	344	9	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAO_A	1.98e-25	6	348	7	331	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAB_A	5.17e-25	6	348	7	331	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAA_A	1.92e-20	10	346	20	335	Structureof a family two carbohydrate esterase from Cellvibrio japonicus [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10477	9.94e-24	6	348	488	812	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
B3PIB0	1.19e-19	10	346	39	354	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=axe2C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004612_00162.