CAZyme Information: MGYG000004612_00907

Basic Information

• Species: UMGS363 sp900768245
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS363; UMGS363 sp900768245
• CAZyme ID: MGYG000004612_00907
• CAZy Family: GH5
• CAZyme Description: Endoglucanase C307

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318		36989.67	4.6342

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004612	2741718	MAG	France	Europe

• Gene Location: Start: 36081; End: 37037 Strand: +

Full Sequence      

MTEFIGYRKGVNLGGWLSQCCHTKEHYDSFITEEDIKVISGWKADHVRLPIDYNLLEDEN
GNFKEDGFGYIDNAVKWAKNYGLNIVIDLHKTAGFSFDKGENESGFFESPALQERFYKLW
ERIAKCYAVSDESIAFELLNEVTEQSYKDIWNSIIKNCIERIRRIAPDTYILVGGYWQNS
PDAVPDLEVPYDNKVIYNFHCYDPLMFTHQGAYWVENMDKDFRLPFDDVEPPITPEFFIE
RFSRANEAAKKNGTVLYCGEYGVINLAEPEDALKWFKAINTAFDRLGISRAAWSYKKMDF
GISDSRMDNIRSEIIKYL

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-	3.2.1.74

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	10	228	4.5e-101	0.6964856230031949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	8.08e-30	28	295	22	268	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.70e-24	10	305	54	369	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC68710.1	3.19e-138	1	318	1	316
QPZ86390.1	5.42e-136	1	315	1	341
QTE72806.1	8.62e-136	1	318	1	316
QTE75915.1	8.62e-136	1	318	1	316
QUA54630.1	1.42e-134	1	318	1	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	5.90e-75	5	318	2	338	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	1.66e-74	5	318	2	338	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
6UJE_A	1.48e-33	2	302	5	292	ChainA, Endoglucanase [Clostridioides difficile],6UJF_A Chain A, Endoglucanase [Clostridioides difficile]
7EC9_A	1.67e-30	33	313	39	323	ChainA, Endoglucanase [Thermotoga maritima MSB8],7EC9_B Chain B, Endoglucanase [Thermotoga maritima MSB8],7EFZ_A Chain A, Endoglucanase [Thermotoga maritima MSB8],7EFZ_B Chain B, Endoglucanase [Thermotoga maritima MSB8]
3AMC_A	4.01e-30	9	318	14	310	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16169	3.73e-111	1	290	1	288	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
P23340	4.56e-74	5	318	2	338	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
A3DJ77	4.56e-74	5	318	2	338	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P0C2S3	1.45e-72	5	318	2	338	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P25472	5.62e-24	46	293	72	297	Endoglucanase D OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004612_00907.