CAZyme Information: MGYG000004612_01054

Basic Information

• Species: UMGS363 sp900768245
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS363; UMGS363 sp900768245
• CAZyme ID: MGYG000004612_01054
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	MGYG000004612_20|CGC1	40921.78	4.734

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004612	2741718	MAG	France	Europe

• Gene Location: Start: 27502; End: 28584 Strand: -

Full Sequence      

MFNKKIISLSLAAFLSGMVLSGCGMVDSGTEASAAKIDSADSLVESYSQTKEKKEETKFK
LSNPNADKTTQQVYQYIASLTNNGVLSGQQESTWMGSVDYEMDYIYDKTGKYPALRGLDY
MNDDFKGVNERAEKWWNDGGLVTICWHTGYDFNGEWNEAMKTEVKDWDKVLTEGTAEYDA
FVKGMDKAAEALLELQKKGVTVLWRPFHEFDGAWFWWGKGGSDNFVKLWQLMYDRYTNHW
GLNNLIWVLGYSGNGNNYESWYPGDEYCDIVGADSYNGGAQGKLAEKITKFVGGSKPLCF
HECGTNPTEAELKEVPWTWFMTWHTDHIVNQNDPDKLKTLYNSSYVITKDELPSFVKTKK

Enzyme Prediction     

No EC number prediction in MGYG000004612_01054.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	62	351	2e-86	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	6.33e-49	63	351	2	311	Glycosyl hydrolase family 26.
COG4124	ManB2	2.07e-18	136	276	108	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN30282.1	3.48e-113	58	355	3	299
ADU20874.1	7.40e-110	61	353	167	460
QQQ74226.1	8.10e-78	63	354	175	467
AWB26443.1	8.74e-77	61	353	48	337
AEK42302.1	5.51e-76	63	354	154	445

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q75_A	6.47e-58	63	352	25	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
3ZM8_A	7.09e-51	61	352	145	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	4.32e-48	63	352	8	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
6HF2_A	2.66e-45	58	355	42	359	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
3WDQ_A	2.92e-44	64	355	37	355	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	8.68e-50	61	352	174	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	2.27e-43	61	355	146	460	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P16699	1.12e-39	61	352	34	355	Mannan endo-1,4-beta-mannosidase A and B OS=Caldalkalibacillus mannanilyticus (strain DSM 16130 / CIP 109019 / JCM 10596 / AM-001) OX=1236954 PE=1 SV=1
Q5AWB7	2.01e-37	63	352	30	350	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P55298	3.78e-37	61	355	156	462	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000059	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004612_01054.