CAZyme Information: MGYG000004612_01307

Basic Information

• Species: UMGS363 sp900768245
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS363; UMGS363 sp900768245
• CAZyme ID: MGYG000004612_01307
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
603		69468.6	5.2043

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004612	2741718	MAG	France	Europe

• Gene Location: Start: 9072; End: 10883 Strand: -

Full Sequence      

MLKTAYKENVTVLPGVFRERMDVNRKYLLELDSQCLLQNFYLEAGIIMPGLQVVDDPAAA
DLHWGWEAPTCQLRGHFLGHWLSAAAHLAAYNKDAELKVKLDKIVSELGRCQQLNGGEWI
GSIPEKYFEKLARKDYIWSPQYVMHKTILGLMHAYTYADNEQALEIIDRLADWYVRWTDE
MQKRNPHAVYSGEEAGMLEVWASLYEITKNEKYMSLATKYYDPSLFRNLKEGKDSLTNCH
ANASIPFIHGAAKLYEVTGDEDWKHIAELFWKNAVTDRGYYCTGGQNAGEFWVPPFMQGH
FLGDNDQEFCTVYNMVRVASYLFKWTGKKEYADYIERCLYNGFLAQQNSVTGMPTYFLPL
SAGSKKKWGSKTHDFWCCHGTMVQAQTIYPELIYFRDEAADKLIISQYIPSCYEFTHKNT
AVRIEQTTGMKYYNDQAFFDEHDDGQMSRWLLKFSVNTDSADRFTISFRVPAWVNGAPEV
EINGVKCDAPEIKDGYLNITSEWNNDTVQIFFPSHIVMEQLPDIPELAAAVDGPIVLAGI
TDADCGIKGDVNDVLIQQTEHTYGTFPWKQNSYRTRNQERNFMLKPLYDITDETYTVYFT
KKN

Enzyme Prediction     

No EC number prediction in MGYG000004612_01307.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	10	538	3.7e-163	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.18e-122	9	538	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.22e-80	1	540	3	503	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04792	LanM-like	1.56e-04	148	268	552	677	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
pfam03663	Glyco_hydro_76	2.33e-04	202	307	164	277	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG1331	YyaL	0.002	189	339	408	564	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL50077.1	1.68e-292	1	601	1	602
CBL17727.1	3.20e-266	8	603	8	595
QUA54004.1	9.58e-265	1	600	1	601
QTE68365.1	3.52e-262	1	600	1	600
QTE71079.1	1.45e-258	1	603	1	601

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	4.58e-60	8	544	31	566	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.37e-57	8	544	31	566	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	1.41e-23	81	529	82	545	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.48e-23	81	529	82	545	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	1.78e-16	81	510	81	532	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	9.76e-16	81	510	81	532	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004612_01307.