CAZyme Information: MGYG000004613_00888

Basic Information

• Species: RUG841 sp900772035
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; RUG841; RUG841 sp900772035
• CAZyme ID: MGYG000004613_00888
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
552		63389.21	9.7129

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004613	2009120	MAG	France	Europe

• Gene Location: Start: 88220; End: 89878 Strand: -

Full Sequence      

MKFEFIKKHPDLFTFLGLFVAFYFLFFHGIGSYALMDVDETRYASMAHDMFRSHDFMTLY
LNGEYFFEKPPLYFWLECLSFGLFGHVSEFTVRFPVCTLGLLSSFLVYFVGKKVVSRGFG
AVAALTLATSAEFLILSKYAILDIVLAFCTTFSIFFGFMTLFCEEKNKKYFWWLFYIFSG
LAVLAKGIPGFVLPFGAMFFVYIAAKKFKELFKPVYFIIGFLIFFAIVLPWHIVMLDKHD
PLFFNEYIMKHHIARFLNSHDLGRKQPFYFFILTILWGIFPWIIPAAATIKTWGKKLIKQ
IQALKTFEFNSMTNPQKFLTVNIIAALLTLAFFSASSTKLVTYILPIYPFLACIMAYLTV
KYITDDEYTKAFNISTIVTGSIFLTTGIVSCFIKLFLPAEIYNDLAVGLPVVPILFIGAG
VLMLISSIKSNKKAVFGSYVLFMMFLSAFGMGTGFNIDYAFGQNDLMKYAKMAKDNNHAI
ASYGFGRRYSLNYYYQKHVIYERNINNYAKLKELLADKNTVVIIRNKNADEISQNAKFTV
IEKGKKYSLIKG

Enzyme Prediction     

No EC number prediction in MGYG000004613_00888.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	14	548	3.2e-101	0.9574074074074074

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.13e-50	8	473	4	450	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.07e-29	6	399	2	372	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	3.57e-16	69	231	2	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.51e-15	12	233	2	232	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1928	PMT1	3.50e-09	10	229	22	259	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38667.1	3.08e-199	3	551	5	555
ACM19911.1	2.25e-46	26	442	30	424
ABQ27847.1	1.86e-43	7	355	10	341
AJQ27709.1	4.91e-43	27	357	21	323
AJE04087.1	4.52e-42	35	355	39	341

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	9.79e-18	35	457	54	452	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	5.35e-23	25	377	15	335	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A1JPM4	7.22e-20	16	365	12	336	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1
B4EUL1	5.22e-19	35	422	31	401	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT1 PE=3 SV=1
Q6D2F3	7.13e-19	20	356	15	332	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=arnT PE=3 SV=1
O67601	7.98e-19	23	363	15	312	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999433	0.000038	0.000004	0.000000	0.000000	0.000574

TMHMM  Annotations     

start	end
12	34
90	109
114	136
141	163
170	184
188	205
212	234
268	290
318	335
340	362
374	396
406	428
435	457