CAZyme Information: MGYG000004613_00993

Basic Information

• Species: RUG841 sp900772035
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; RUG841; RUG841 sp900772035
• CAZyme ID: MGYG000004613_00993
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000004613_6|CGC2	42003.4	8.1922

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004613	2009120	MAG	France	Europe

• Gene Location: Start: 75460; End: 76578 Strand: +

Full Sequence      

MKKIFIITGEYSGDKHASGIAREIFKTNPDVSIEAVGGSNLEAAGVKLFCNHEKMSAMGL
SLKIIIDHITLGKKVADYLINDYKPDLVLLVDYGGFNLNIAKVLKKAGLKIFYYIPPQIW
ASRKWRLNTVKKYIDKVITIYPFEIDMYKGIGVDAEFSGNPLVMQLPPMVDRESFLNEYG
FDKEKKLVSIFPGSRIFEVKNLLKIFLKAADIIAKKMPNVQFAICQAPTIKDEQITPFVP
ENIKLLQGKNYELLAYSDALILASGTVALEASLYDTPMIISYKGPELFYWIYLLVRCIDK
VSLPNIILQKNVVPELVQHLAKPEIIANHIIELLTDEAKYQEMKNELANVRHFLTDKNSG
VEAAKIILNELQ

Enzyme Prediction     

No EC number prediction in MGYG000004613_00993.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	353	8.9e-100	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.13e-111	1	369	1	373	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.68e-96	1	372	1	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.42e-72	4	354	1	356	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	8.74e-63	4	343	8	355	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.26e-34	1	324	1	307	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	1.88e-143	1	371	1	372
AKQ33376.1	1.05e-77	2	368	6	373
QKJ96197.1	4.02e-75	3	368	7	375
BBL71468.1	1.23e-74	3	366	8	375
BCS52429.1	1.34e-74	2	372	11	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.00e-43	4	372	9	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.73e-43	4	372	9	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	8.31e-73	2	368	4	375	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q3JAC1	7.32e-72	4	354	8	362	Lipid-A-disaccharide synthase OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=lpxB PE=3 SV=1
Q39T49	4.16e-70	2	371	7	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B6J161	4.69e-70	2	369	4	372	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9KC41	6.61e-70	2	369	4	372	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004613_00993.