CAZyme Information: MGYG000004616_01397

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter
• CAZyme ID: MGYG000004616_01397
• CAZy Family: GH9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
471		52808.83	5.5814

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004616	2217766	MAG	France	Europe

• Gene Location: Start: 5181; End: 6596 Strand: +

Full Sequence      

MNGLYCQRSGTVTGEPYTRFTRPRVYHPDDGRVIRQSRCSLMESGNGLNCYGTDVNNFGN
LVRKATDEVVENAWGGTFDACDWDRRIQHLRATQLLTELYLMFPEYYGELHLPIPESGNG
LPDILNEGLYNVDFYRRLQLPDGGIRGGIEAAEHPILGECGWQDSWPAWAYAPDFWSSHW
YASAAARMAYAIRPMDPEKSAVYQESAQRAMDWAEEQHPQLLASEGHKWTPSAHQRIRDT
RELAAVDMYRLTGEAKYDALYRQLRQERSYEAAFVYATLPGGMGDGETRQACVHTIVQAA
ERALAFGEKAPYHLTASDPESTSTGSWGSFYTVAKMTELARAHYLTGDNRYLAAAEAACG
FGCGANPDNLCYTTGVGIRNVVNILHHDSRITGQPAPAGITVAGPQNLRFSDRDGFIPYL
RHDRFWPGVYAWPAAESYFDAYRIAPEKEYTVQGNIGPNLYNWGYLAAVKE

Enzyme Prediction     

No EC number prediction in MGYG000004616_01397.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH9	4	453	1.1e-31	0.9449760765550239

CDD Domains     

MGYG000004616_01397 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAU09603.1	2.23e-108	3	468	322	783
BAY54436.1	4.10e-108	3	468	322	783
BAS59224.1	4.10e-108	3	468	322	783
BAS65572.1	4.10e-108	3	468	322	783
QEH32718.1	4.67e-93	1	468	528	997

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3X17_A	4.33e-17	5	407	128	513	Crystalstructure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium],3X17_B Crystal structure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium]
1UT9_A	3.74e-11	107	412	212	560	ChainA, CELLULOSE 1,4-BETA-CELLOBIOSIDASE [Acetivibrio thermocellus]
1RQ5_A	3.75e-11	107	412	212	560	ChainA, Cellobiohydrolase [Acetivibrio thermocellus]
5U0H_A	3.20e-09	75	263	140	337	Crystalstructure of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]
5U2O_A	9.77e-09	75	263	140	337	Crystalstructure of Zn-binding triple mutant of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3DCH1	1.89e-10	107	412	419	767	Cellulose 1,4-beta-cellobiosidase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celK PE=3 SV=1
P0C2S1	2.50e-10	107	412	419	767	Cellulose 1,4-beta-cellobiosidase OS=Acetivibrio thermocellus OX=1515 GN=celK PE=1 SV=1
Q05156	6.57e-09	104	412	372	699	Cellulase 1 OS=Streptomyces reticuli OX=1926 GN=cel1 PE=1 SV=1
P0C2S4	7.41e-08	76	390	171	495	Endoglucanase D (Fragment) OS=Acetivibrio thermocellus OX=1515 GN=celD PE=1 SV=1
A3DDN1	7.56e-08	76	390	195	519	Endoglucanase D OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000013	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004616_01397.