CAZyme Information: MGYG000004621_00147

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004621_00147
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387		44555.55	9.5073

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004621	2838817	MAG	France	Europe

• Gene Location: Start: 14665; End: 15828 Strand: -

Full Sequence      

MKYYLIVGEASGDLHASRLMQSLRTYDAAAEFRFFGGDLMARVGGHRVRHYKELAYMGFV
PVLLHLPAIFRNMALCKRDIVAWQPDVVILVDYPGFNLGIAKFVHSHTHIPVYYYISPKI
WAWKEWRIKRIRRDVDELFSILPFEVPFYEERHHYPIHYVGNPTAEEVRAFLAGYHEDQK
SFCRRHRLDERKPIIALLAGSRKQEIKDNLPAMSASLTADLLRDFQAVIAGAPSIDRDYY
APFMGDGRLRLIFDDTYALLAHATVALVTSGTATLETALFRVPQVVCYKTPLPRLMRWGF
NHIIKCPFISLVNLIAGREVVPELFADRFTVTNIRDWTRRLLPGQSDRETMLRGYDEVSR
RLGDRVAPDEAARIMVDKLSNGQRGSR

Enzyme Prediction     

No EC number prediction in MGYG000004621_00147.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	362	1.4e-109	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	7.04e-99	1	380	2	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	1.24e-98	1	367	2	368	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	2.22e-66	4	324	2	321	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.08e-54	5	334	10	337	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.39e-42	1	334	2	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB72247.1	1.05e-192	1	387	1	384
QUB65076.1	1.59e-190	1	383	1	380
QUB84094.1	2.47e-190	1	380	1	377
QKH89215.1	4.55e-190	1	383	1	380
QUB55731.1	6.46e-190	1	383	1	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.33e-28	5	380	11	381	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	4.42e-28	5	380	11	381	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02AZ6	1.64e-62	2	383	3	376	Lipid-A-disaccharide synthase OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=lpxB PE=3 SV=1
Q1D393	9.54e-62	5	383	9	382	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
C1F718	2.09e-61	4	381	8	387	Lipid-A-disaccharide synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) OX=240015 GN=lpxB PE=3 SV=1
Q6ALW0	8.67e-60	5	379	14	386	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q39T49	8.92e-59	5	379	11	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000008	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004621_00147.