CAZyme Information: MGYG000004621_00187

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004621_00187
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407	MGYG000004621_3|CGC1	46585.1	5.2707

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004621	2838817	MAG	France	Europe

• Gene Location: Start: 73059; End: 74282 Strand: +

Full Sequence      

MDKKAILFATFAMTFFSCGGIEVEKYIPPTMKQDTISTEKIVYKDQAKHLYDLISERYLI
KSGTYKGLYLENYPIQSGDPEHSYLWNYVSLMSGVSLLNQLGYNVNYADKMNGFERYYSV
SGVQNVGGYSSSTNGTSGTGTRFYDDNSIVGLEMLRAYDQLNDSKFLDHCRQIVAFLESG
EDDINGDALWWNEAQKNMAGNTDSNKPACANGFACNFLLKYYQVCPSDEKKNVLDFAKRL
YTWLYYNLRDPEDNTYWNDMQVDKTINKTKWTYNSGVMISNGIQLYRITGDQNYLSQAIK
TAEGAYNYFVRPRGNMALAYPDSDPWFNTKLFDAYIELIPYHSTAAKYVDTYIHFMDNAI
TSARTRDGFFYEDWTGSSPKRYYSLLTQGAALESLARISIYKGEASH

Enzyme Prediction     

No EC number prediction in MGYG000004621_00187.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	51	386	2.8e-48	0.8854748603351955

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	1.23e-12	127	316	72	262	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	2.71e-04	115	302	72	241	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT30760.1	4.49e-164	1	404	1	403
QRN00400.1	4.49e-164	1	404	1	403
QUT25298.1	6.37e-164	1	404	1	403
CBK66335.1	9.03e-164	1	404	1	403
QDH57403.1	2.58e-163	1	404	1	403

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MU9_A	1.21e-27	52	398	9	362	Crystalstructure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4C1S_A	7.16e-22	142	404	105	373	Glycosidehydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
4V1S_A	2.83e-19	114	328	113	325	Structureof the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1S_B Structure of the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4V1R_A	1.86e-17	114	328	113	325	Structureof a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1R_B Structure of a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6SHD_A	8.42e-16	143	302	133	286	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000098	0.029657	0.970182	0.000021	0.000030	0.000022

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004621_00187.